Potri.011G155700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G20440 218 / 1e-70 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
AT5G44500 208 / 1e-66 Small nuclear ribonucleoprotein family protein (.1.2)
AT1G76860 45 / 2e-06 Small nuclear ribonucleoprotein family protein (.1)
AT1G21190 45 / 4e-06 Small nuclear ribonucleoprotein family protein (.1)
AT3G62840 40 / 0.0003 Small nuclear ribonucleoprotein family protein (.1.2)
AT2G47640 40 / 0.0003 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
AT3G11500 39 / 0.0003 Small nuclear ribonucleoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G440100 248 / 1e-81 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Potri.005G191600 45 / 2e-06 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1)
Potri.002G068800 45 / 2e-06 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1)
Potri.006G174000 42 / 3e-05 AT4G30330 166 / 3e-55 Small nuclear ribonucleoprotein family protein (.1)
Potri.018G096200 42 / 3e-05 AT4G30330 166 / 3e-55 Small nuclear ribonucleoprotein family protein (.1)
Potri.002G204300 42 / 5e-05 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.014G129100 42 / 5e-05 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.006G211100 41 / 6e-05 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1)
Potri.016G078100 39 / 0.0003 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038421 244 / 2e-80 AT5G44500 263 / 2e-88 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10013108 237 / 7e-78 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10023386 236 / 2e-77 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10003498 79 / 3e-17 AT5G44500 81 / 1e-18 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10030367 42 / 5e-05 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10007876 42 / 5e-05 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10026556 42 / 5e-05 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10013840 42 / 5e-05 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Lus10026326 42 / 7e-05 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1)
Lus10011293 42 / 7e-05 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0527 Sm-like PF01423 LSM LSM domain
Representative CDS sequence
>Potri.011G155700.2 pacid=42780474 polypeptide=Potri.011G155700.2.p locus=Potri.011G155700 ID=Potri.011G155700.2.v4.1 annot-version=v4.1
ATGTCGATGTCAAAGAGTTCGAAGATGCTCCAATATATCAACTACCGGATGCGTGTGACCATCCAAGATGGCCGGCAGCTGGTAGGGAAATTCATGGCCT
TTGATCGCCACATGAACCTTGTACTCGGTGATTGTGAGGAGTTCCGTAAGCTCCCACCAGCAAAGGGCAAGAAGAATAATGAGGAGCGTGAGGACCGCCG
TACTCTTGGCCTTGTTCTCCTTCGTGGTGAAGAGGTCATCTCTATGACTGTTGAGGGCCCTCCTCCTCCTGAAGAGTCTCGTGCCAAGGCTGTCTCTGCT
GCAGCTGTTGCTGGTCCCGGTCTTGGTCGTGCTGCTGGCCGTGGAATTCCTACTGCTCCTCTTGTTCAGGCGCAGCCTGGCCTAGCAGGTCCTGTCCGTG
GTGTTGGTGGGCCTTCCCCTGGCATGATGCAGCCACAACTCTCTCGTCCTCAACTTTCTGCTCCACCCATGACTTACCCCGCAGGAAGTGGTCTGCCAAC
TGGTGGTGCACCTATTCTCCGGCCACCTGGTCAGATGCCTCCTATGCCATATTCTGGACAGGGTCCACCAATGGGCCGGGGTCCACCTCCACCAGGTCCA
CCTCAATTTGCTGCTAGGCCCCCACAGGGTTTCCCGATGCCACCACAGTTTGCCCAGAGACCAATGGGAGGGCCACCACAGCCACAGGTACAAATGATGA
GAGGACCACCTGCTCCACCAAGACCTGGAATGCCAGCACCACCTCCACCCCGTCCTGGGATGCCACTTCCACCTGGTGGTCATGTTCCTGTTTTTGGACC
CCCTCGTCCGGGTATGCCACCTCCTCCCAATTCCCAACAGCAGCAGAATCAGCAGCAATAG
AA sequence
>Potri.011G155700.2 pacid=42780474 polypeptide=Potri.011G155700.2.p locus=Potri.011G155700 ID=Potri.011G155700.2.v4.1 annot-version=v4.1
MSMSKSSKMLQYINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKNNEEREDRRTLGLVLLRGEEVISMTVEGPPPPEESRAKAVSA
AAVAGPGLGRAAGRGIPTAPLVQAQPGLAGPVRGVGGPSPGMMQPQLSRPQLSAPPMTYPAGSGLPTGGAPILRPPGQMPPMPYSGQGPPMGRGPPPPGP
PQFAARPPQGFPMPPQFAQRPMGGPPQPQVQMMRGPPAPPRPGMPAPPPPRPGMPLPPGGHVPVFGPPRPGMPPPPNSQQQQNQQQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G20440 SMB small nuclear ribonucleoprotei... Potri.011G155700 0 1
AT3G27740 VEN6, CARA VENOSA 6, carbamoyl phosphate ... Potri.003G080900 1.73 0.9149 Pt-CARA.2
AT4G30930 WRKY32, NFD1 NUCLEAR FUSION DEFECTIVE 1, Ri... Potri.015G095700 4.47 0.8873 Pt-RPL21.5
AT1G75330 OTC ornithine carbamoyltransferase... Potri.005G229400 4.58 0.8507
AT5G11880 Pyridoxal-dependent decarboxyl... Potri.009G119300 6.32 0.8404
AT3G49470 NACA2 nascent polypeptide-associated... Potri.012G006700 7.34 0.8209
AT5G60390 GTP binding Elongation factor ... Potri.010G218600 11.22 0.8148
AT5G64670 Ribosomal protein L18e/L15 sup... Potri.001G324300 11.74 0.8515
AT3G20330 PYRB PYRIMIDINE B (.1) Potri.001G357200 12.60 0.8655
AT3G49320 Metal-dependent protein hydrol... Potri.015G007900 13.85 0.8652
AT5G54580 RNA-binding (RRM/RBD/RNP motif... Potri.001G409800 14.83 0.8548

Potri.011G155700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.