Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G28610 305 / 1e-101 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28580 304 / 5e-101 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28510 304 / 1e-100 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28600 301 / 3e-100 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G40010 297 / 6e-98 ASD, AATP1 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) AT3G28540 296 / 6e-98 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT5G40000 293 / 8e-97 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28570 280 / 6e-92 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28520 275 / 5e-90 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G50940 249 / 6e-80 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G067400 [exp] 387 / 3e-133 AT5G40010 538 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.013G047950 [exp] 327 / 1e-109 AT5G40010 538 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.013G047900 [exp] 326 / 2e-109 AT5G40010 537 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.019G020800 [exp] 325 / 2e-108 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.019G020700 [exp] 322 / 2e-107 AT5G40010 531 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G091500 [exp] 320 / 4e-107 AT5G40010 582 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G012700 [exp] 315 / 1e-105 AT5G40010 566 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G012601 [exp] 315 / 1e-105 AT5G40010 566 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Potri.004G012500 [exp] 311 / 5e-104 AT5G40010 556 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042166 [exp] 344 / 4e-116 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10004258 [exp] 343 / 5e-116 AT3G28580 507 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10014496 [exp] 332 / 2e-111 AT5G40010 577 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10015354 [exp] 307 / 7e-102 AT5G40010 598 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10015349 [exp] 298 / 7e-99 AT5G40010 536 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10014498 [exp] 292 / 5e-96 AT5G40010 598 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10030667 [exp] 286 / 8e-94 AT5G40010 501 / 2e-174 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10005256 [exp] 286 / 4e-92 AT5G40010 501 / 4e-172 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10006968 [exp] 242 / 7e-79 AT5G57480 399 / 3e-137 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10025479 [exp] 239 / 3e-77 AT5G57480 487 / 4e-171 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00004 [poplar] [flax] AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence Show only first row Show all	>Potri.012G072300.2 pacid=42783408 polypeptide=Potri.012G072300.2.p locus=Potri.012G072300 ID=Potri.012G072300.2.v4.1 annot-version=v4.1 ATGGAGCCTGCAAAGAAGGAGATTATAGAAGATCTGGTGACTTTCAGCAAGAGCAAGGATTTCTATGCCAGAACTGGGAAGACGTGGAAGCGAGGGTATC TTCTTTATGGTCCACCGGGGACCGGAAAGTCTACCATGATTGCTGCAATGGCTAACTTGTTAAACTATGATGTTTATGATCTCGAGCTCACAGCTGTGAA AGAAAATACCGAGCTTAGGAAGCTTTTGATTGAGAGTACTAGAAAATCCATCATAGTGATTGAAGACATAGATTGCTCGCTTGATCTGACTGGTCAGCGG ACTAAGAAAGAAGAGAAATCTCCAGATGAGGACAAGGAGAAGTCGGAGAAAGAAATTCGCAAAGAACATAAAGAAGAGAGCAGCAGCAAAGTGACACTTT CTGGGTTGTTGAATTTCATTGATGGGCTATGGTCTGCTAGTGGAGGGGAGAGGCTTATTGTGTTCACTACTAATTACGTGGAGAAGCTTGATCCTGCTCT GACAAGAAGGGGAAGAATGGACAAGCATATTGAGCTCTCTTACTGCATTTTTGAGGCATTCGAAGTGCTTTCAAGGAATTACCTGAGACTTGAAGCGCAT CCTTTGCTTGATAAAATTGAAAGCTTAATGAAGGTGACCAAGATCACACCAGCAGATGTTGCGGAGAACCTCATGCCCAAGTCTCCTTTGGATGATGCAG AGAAGTGCCTTTCACGCTTAATTCAAGCTCTTGAGGAAGCAAAAGAAGCAGCAGAAGCTACAGAAAATGATGAGAGAAGCATCCACAAAAAAAAAAGCTC AAGCAGCTACCAAGGCAGCAGAGGTCCCTGCCACGGAAGATGTTGCCCAACCACAAGAAAATAG
AA sequence Show only first row Show all	>Potri.012G072300.2 pacid=42783408 polypeptide=Potri.012G072300.2.p locus=Potri.012G072300 ID=Potri.012G072300.2.v4.1 annot-version=v4.1 MEPAKKEIIEDLVTFSKSKDFYARTGKTWKRGYLLYGPPGTGKSTMIAAMANLLNYDVYDLELTAVKENTELRKLLIESTRKSIIVIEDIDCSLDLTGQR TKKEEKSPDEDKEKSEKEIRKEHKEESSSKVTLSGLLNFIDGLWSASGGERLIVFTTNYVEKLDPALTRRGRMDKHIELSYCIFEAFEVLSRNYLRLEAH PLLDKIESLMKVTKITPADVAENLMPKSPLDDAEKCLSRLIQALEEAKEAAEATENDERSIHKKKSSSSYQGSRGPCHGRCCPTTRK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G28610			P-loop containing nucleoside t...		Potri.012G072300 [exp]	0	1
AT3G02970		EXL6	EXORDIUM like 6 (.1)		Potri.013G080100 [exp]	1.00	0.8699
AT1G10240	FAR1_related	FRS11	FAR1-related sequence 11 (.1)		Potri.004G227400 [exp]	1.73	0.8586
AT3G60800			DHHC-type zinc finger family p...		Potri.002G147300 [exp]	2.82	0.8542
AT1G11900			Tetratricopeptide repeat (TPR)...		Potri.009G067400 [exp]	4.00	0.8318
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.001G129400 [exp]	4.69	0.8652	CYP89A27P
AT5G66360		DIM1B	adenosine dimethyl transferase...		Potri.006G264101 [exp]	5.00	0.8514
AT4G38870			F-box and associated interacti...		Potri.008G144000 [exp]	5.00	0.7915
AT2G35140			DCD (Development and Cell Deat...		Potri.015G122300 [exp]	7.00	0.8324
AT5G36170		ATPRFB, HCF109	high chlorophyll fluorescent 1...		Potri.010G181600 [exp]	9.48	0.7717	Pt-HCF109.1
AT4G21510			F-box family protein (.1)		Potri.011G042800 [exp]	9.59	0.7716

Compare expression of checked genes

Potri.012G072300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.