Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) AT2G32300 109 / 1e-29 UCC1 uclacyanin 1 (.1) AT2G31050 106 / 3e-29 Cupredoxin superfamily protein (.1) AT2G26720 102 / 2e-27 Cupredoxin superfamily protein (.1) AT5G26330 93 / 4e-24 Cupredoxin superfamily protein (.1) AT2G02850 81 / 3e-20 ARPN plantacyanin (.1) AT3G60270 81 / 1e-19 Cupredoxin superfamily protein (.1) AT4G31840 81 / 2e-19 AtENODL15 early nodulin-like protein 15 (.1) AT3G27200 79 / 8e-19 Cupredoxin superfamily protein (.1) AT5G07475 79 / 2e-18 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G030000 [exp] 317 / 1e-112 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.003G117900 [exp] 196 / 4e-65 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1) Potri.019G037800 [exp] 132 / 1e-39 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1) Potri.013G061300 [exp] 128 / 3e-38 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1) Potri.013G054500 [exp] 125 / 2e-37 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 101 / 1e-27 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 99 / 2e-26 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.002G101300 [exp] 95 / 7e-25 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 92 / 9e-24 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007027 [exp] 134 / 4e-40 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1) Lus10002617 [exp] 130 / 2e-37 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1) Lus10007028 [exp] 126 / 2e-37 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1) Lus10006682 [exp] 126 / 3e-37 AT2G32300 95 / 1e-24 uclacyanin 1 (.1) Lus10020276 [exp] 130 / 3e-36 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2) Lus10007025 [exp] 123 / 4e-36 AT2G32300 101 / 3e-27 uclacyanin 1 (.1) Lus10006680 [exp] 120 / 5e-35 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1) Lus10007026 [exp] 118 / 4e-34 AT2G32300 96 / 4e-25 uclacyanin 1 (.1) Lus10006683 [exp] 111 / 2e-31 AT5G26330 88 / 1e-22 Cupredoxin superfamily protein (.1) Lus10002614 [exp] 104 / 4e-29 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.013G030450.1 pacid=42812346 polypeptide=Potri.013G030450.1.p locus=Potri.013G030450 ID=Potri.013G030450.1.v4.1 annot-version=v4.1 ATGGCGTCTTGTAGGATATTCATGATCATCGCCATTGTTGCAGTCTTCGTTCCTTCAATCTTGGCAACAGAACATATGGTTGGTGACAAGACAGGTTGGA CCCTAGGCTTTAATTATCAAACCTGGGCTCAGGGAAAAGCATTTTACGTGGGAGACACACTAGTTTTCAAGTATACGCCAGGAGCACACAATGTGTTGAG TGTTAATGGAACTGGATTCGAAGAGTGCAAGGCAGCTGATGATATTGTGCCCTTGACTACAGGAAATGATGTGATTACACTCTCAACTCCTGGGAAGAAA TGGTACATTTGTAGTGTGCCCGGGCACTGTGAGTCTGGGAACCAGAAGCTTTTCATAACTGTGTTGCCTCAACTGTCATCTCCAGCAACATCACCTTTTC CCGGCCCAACTGACACCTCCCCATCCGGAGCAGCAGGCAACATTGCTTCTACATACTATGGGTTGATTGCGGCCATTGTAGGCATCTTTGGGATGATCAT GTTTTAA
AA sequence Show only first row Show all	>Potri.013G030450.1 pacid=42812346 polypeptide=Potri.013G030450.1.p locus=Potri.013G030450 ID=Potri.013G030450.1.v4.1 annot-version=v4.1 MASCRIFMIIAIVAVFVPSILATEHMVGDKTGWTLGFNYQTWAQGKAFYVGDTLVFKYTPGAHNVLSVNGTGFEECKAADDIVPLTTGNDVITLSTPGKK WYICSVPGHCESGNQKLFITVLPQLSSPATSPFPGPTDTSPSGAAGNIASTYYGLIAAIVGIFGMIMF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G17675			Cupredoxin superfamily protein...		Potri.013G030450 [exp]	0	1
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.005G051500 [exp]	5.91	0.9759
AT5G39160			RmlC-like cupins superfamily p...		Potri.011G163300 [exp]	8.12	0.9824	GER2.30
AT5G64260		EXL2, MSJ1.10	EXORDIUM like 2 (.1)		Potri.005G163000 [exp]	8.94	0.9731
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.013G038901 [exp]	10.24	0.9764
					Potri.007G117900 [exp]	12.36	0.9814
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Potri.016G015800 [exp]	13.26	0.9804
					Potri.001G297101 [exp]	13.85	0.9573
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Potri.005G104900 [exp]	15.49	0.9590
AT5G39190		ATGER2, GLP2A	GERMIN-LIKE PROTEIN 2A, A. THA...		Potri.011G162200 [exp]	22.22	0.9678	GER2.33
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.018G095200 [exp]	22.69	0.9400	EXT.7

Compare expression of checked genes

Potri.013G030450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.