Potri.013G061300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17675 102 / 8e-29 Cupredoxin superfamily protein (.1)
AT2G32300 102 / 3e-27 UCC1 uclacyanin 1 (.1)
AT5G07475 89 / 7e-23 Cupredoxin superfamily protein (.1)
AT3G27200 83 / 1e-20 Cupredoxin superfamily protein (.1)
AT5G20230 83 / 3e-20 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
AT2G26720 82 / 7e-20 Cupredoxin superfamily protein (.1)
AT2G02850 79 / 1e-19 ARPN plantacyanin (.1)
AT5G26330 80 / 4e-19 Cupredoxin superfamily protein (.1)
AT2G31050 79 / 7e-19 Cupredoxin superfamily protein (.1)
AT1G72230 78 / 2e-18 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G117900 136 / 1e-41 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.013G030450 135 / 6e-41 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030000 134 / 1e-40 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G054500 130 / 2e-39 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1)
Potri.019G037800 125 / 2e-37 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1)
Potri.002G101300 100 / 3e-27 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.002G101200 99 / 5e-26 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.001G192100 94 / 3e-24 AT5G20230 100 / 2e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.001G332200 92 / 3e-24 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002617 142 / 3e-42 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1)
Lus10006682 129 / 1e-38 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Lus10020276 134 / 5e-38 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2)
Lus10007028 123 / 4e-36 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10007027 121 / 2e-35 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1)
Lus10007026 118 / 3e-34 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10007025 113 / 3e-32 AT2G32300 101 / 3e-27 uclacyanin 1 (.1)
Lus10006683 112 / 5e-32 AT5G26330 88 / 1e-22 Cupredoxin superfamily protein (.1)
Lus10008720 112 / 6e-32 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10006680 110 / 5e-31 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.013G061300.1 pacid=42811075 polypeptide=Potri.013G061300.1.p locus=Potri.013G061300 ID=Potri.013G061300.1.v4.1 annot-version=v4.1
ATGGCTTCTCGTTGTGTATTGGCGATCTTTGTTCTCATAGCTGCCATTGTTCCAATGACAACTTTGGCAACAGAGTACATAGTTGGGGACGAAAGTGGAT
GGACCTTAGGGTTTGAATATCATGCCTGGGCTGCGGGCAAGAACTTTCTTGTCGGTGACGAACTTGTTTTCAAATATCCCGTTGGTGCTCACAACGTGTT
TAAAGTGAACGGAACTGAATTCCAGAACTGTATTATTCCGCCGGCAGATAGGGCTCTAACTAGTGGAGATGACACCATTGTTTTGGCTAGTCCAGGAAAG
AAATGGTATATTTGTGGAGTGGGCAAGCACTGTGAATTTGGTCAAAAGCTTGCTATAACTGTGCAATCTTTGGCACCAACTCCAAGCCCTGCACCGTCGC
CACTCTATGCTAAGCCTGATGAGGCGGTGAAAGGCAAGCGACCTTTCTTCACATTGCGTTGGTGGTGA
AA sequence
>Potri.013G061300.1 pacid=42811075 polypeptide=Potri.013G061300.1.p locus=Potri.013G061300 ID=Potri.013G061300.1.v4.1 annot-version=v4.1
MASRCVLAIFVLIAAIVPMTTLATEYIVGDESGWTLGFEYHAWAAGKNFLVGDELVFKYPVGAHNVFKVNGTEFQNCIIPPADRALTSGDDTIVLASPGK
KWYICGVGKHCEFGQKLAITVQSLAPTPSPAPSPLYAKPDEAVKGKRPFFTLRWW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G17675 Cupredoxin superfamily protein... Potri.013G061300 0 1
AT5G59090 ATSBT4.12 subtilase 4.12 (.1.2.3) Potri.012G133200 1.41 0.9993
AT5G48450 SKS3 SKU5 similar 3 (.1) Potri.008G032100 1.41 0.9994
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.010G000400 2.44 0.9993 MALD1.1
AT4G34860 A/N-InvB alkaline/neutral invertase B, ... Potri.005G239400 3.00 0.9978
AT5G24090 ATCHIA chitinase A (.1) Potri.014G091700 3.16 0.9984 CHI3.4
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Potri.005G216000 3.46 0.9982 3
AT3G08680 Leucine-rich repeat protein ki... Potri.011G088000 5.29 0.9987
Potri.002G158600 5.65 0.9981
AT4G28780 GDSL-like Lipase/Acylhydrolase... Potri.004G180400 6.32 0.9977
AT1G66350 GRAS RGL1 RGA-like 1 (.1) Potri.001G326000 7.48 0.9982

Potri.013G061300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.