Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22810 140 / 5e-43 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G71520 138 / 2e-42 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G50260 114 / 1e-32 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT5G67190 105 / 4e-29 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT4G06746 99 / 6e-27 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT1G74930 98 / 5e-26 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1) AT1G46768 96 / 1e-25 AP2_ERF RAP2.1 related to AP2 1 (.1) AT4G36900 96 / 3e-25 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT2G23340 96 / 4e-25 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1) AT1G19210 92 / 1e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G073300 [exp] 230 / 4e-78 AT1G22810 144 / 1e-44 Integrase-type DNA-binding superfamily protein (.1) Potri.007G046500 [exp] 100 / 3e-27 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.005G140900 [exp] 98 / 4e-26 AT5G67190 169 / 1e-53 DREB and EAR motif protein 2 (.1) Potri.014G025200 [exp] 97 / 4e-26 AT1G46768 160 / 3e-51 related to AP2 1 (.1) Potri.002G124000 [exp] 93 / 3e-24 AT1G46768 158 / 3e-50 related to AP2 1 (.1) Potri.006G218200 [exp] 91 / 3e-23 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 89 / 6e-23 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 87 / 7e-22 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.002G085600 [exp] 87 / 1e-21 AT1G77640 127 / 3e-36 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041044 [exp] 147 / 1e-45 AT1G71520 138 / 9e-43 Integrase-type DNA-binding superfamily protein (.1) Lus10009468 [exp] 146 / 1e-45 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10006179 [exp] 117 / 4e-34 AT1G71520 123 / 7e-37 Integrase-type DNA-binding superfamily protein (.1) Lus10009373 [exp] 104 / 1e-28 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10018727 [exp] 93 / 4e-24 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10010043 [exp] 92 / 6e-24 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10033420 [exp] 93 / 1e-23 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 92 / 2e-23 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10034885 [exp] 92 / 2e-23 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1) Lus10009798 [exp] 88 / 2e-22 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.013G100300.1 pacid=42812021 polypeptide=Potri.013G100300.1.p locus=Potri.013G100300 ID=Potri.013G100300.1.v4.1 annot-version=v4.1 ATGAGCGGTAGTAGCAGCAGCAGAACAGATCAAGAAAGTGGAGCAAGTGCAGCTCGGAAGAAATTCAAGGGAGTGAGGAGGCGGAAATGGGGCAAGTGGG TGTCTGAAATAAGGATTCCTGGCAAGCAAGATCGACTTTGGTTAGGTTCTTATTCAACACCCGAGGCAGCTGCGGTGGCTCATGACATAGCCTCTTATTG TTTACGCGGACCTTCTTCGATAGAGAGTCTCAATTTCCCTCTAATGTTGCCTGCAAGTGTAAGGGAAGACATGTCACCTAAGTCCATACAGAAAGCTGCT TCAGATGCTGGCATGGCAATTGATGCTCAAATGATACTGAACAGGGTACCAGAAAATGAGGTCAAGTTCTGGACTGCAAGTGGTGGGGTTAATCATGGGC TGGAGATAGAGTTATGCGAACCTGCAGGTGGCGATCATGGTGGTAATTGGCATGGAAACAATACTGGAATGAGAGAAGGGGACATCTCCATTGAAGATTA TCTCTAG
AA sequence Show only first row Show all	>Potri.013G100300.1 pacid=42812021 polypeptide=Potri.013G100300.1.p locus=Potri.013G100300 ID=Potri.013G100300.1.v4.1 annot-version=v4.1 MSGSSSSRTDQESGASAARKKFKGVRRRKWGKWVSEIRIPGKQDRLWLGSYSTPEAAAVAHDIASYCLRGPSSIESLNFPLMLPASVREDMSPKSIQKAA SDAGMAIDAQMILNRVPENEVKFWTASGGVNHGLEIELCEPAGGDHGGNWHGNNTGMREGDISIEDYL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G22810	AP2_ERF		Integrase-type DNA-binding sup...		Potri.013G100300 [exp]	0	1
AT1G32640	bHLH	JIN1, JAI1, ZBF...	JASMONATE INSENSITIVE 1, Basic...		Potri.003G092200 [exp]	3.46	0.9043	ATMYC2.1
AT4G17500	AP2_ERF	ATERF-1, AtERF1	ethylene responsive element bi...		Potri.003G081200 [exp]	3.87	0.9234
AT4G23030			MATE efflux family protein (.1...		Potri.003G121400 [exp]	7.93	0.8762
					Potri.010G078950 [exp]	8.48	0.9147
					Potri.010G150750 [exp]	9.79	0.9133
AT2G01670		ATNUDT17	nudix hydrolase homolog 17 (.1...		Potri.008G134000 [exp]	10.24	0.8946
AT2G42760			unknown protein		Potri.004G059900 [exp]	11.66	0.7685
AT1G30135	ZIM	TIFY5A, JAZ8	jasmonate-zim-domain protein 8...		Potri.011G083900 [exp]	13.60	0.8975
AT1G32640	bHLH	JIN1, JAI1, ZBF...	JASMONATE INSENSITIVE 1, Basic...		Potri.001G142200 [exp]	18.24	0.8887	ATMYC2.2
AT1G19180	ZIM	TIFY10A, JAZ1	jasmonate-zim-domain protein 1...		Potri.006G139400 [exp]	19.74	0.8956

Compare expression of checked genes

Potri.013G100300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.