Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	DREB36,DREB1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G46768 160 / 3e-51 AP2_ERF RAP2.1 related to AP2 1 (.1) AT5G67190 158 / 5e-50 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT3G50260 153 / 2e-48 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT2G23340 151 / 4e-47 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1) AT4G36900 149 / 2e-46 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT4G06746 146 / 1e-45 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT4G16750 98 / 2e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G71450 97 / 4e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G21910 95 / 1e-24 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT2G35700 94 / 1e-24 AP2_ERF ATERF38 ERF family protein 38 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G124000 [exp] 251 / 6e-87 AT1G46768 158 / 3e-50 related to AP2 1 (.1) Potri.005G140900 [exp] 159 / 2e-50 AT5G67190 169 / 1e-53 DREB and EAR motif protein 2 (.1) Potri.007G046500 [exp] 157 / 2e-49 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.013G101100 [exp] 100 / 2e-27 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138900 [exp] 98 / 2e-26 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 98 / 4e-26 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.013G100300 [exp] 97 / 4e-26 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 97 / 5e-26 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.019G073300 [exp] 97 / 1e-25 AT1G22810 144 / 1e-44 Integrase-type DNA-binding superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018727 [exp] 196 / 1e-64 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10010043 [exp] 182 / 1e-59 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10009373 [exp] 155 / 4e-49 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10009798 [exp] 97 / 6e-26 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 97 / 3e-25 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10043240 [exp] 96 / 7e-25 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10001601 [exp] 95 / 1e-24 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10033420 [exp] 94 / 2e-24 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 94 / 3e-24 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10019665 [exp] 92 / 2e-23 AT4G39780 209 / 1e-67 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.014G025200.3 pacid=42764403 polypeptide=Potri.014G025200.3.p locus=Potri.014G025200 ID=Potri.014G025200.3.v4.1 annot-version=v4.1 ATGGAAGGAGGGTGCTGTACATCGTCAACAAGTACTCCAAGTTCAACTTCAACAGCAACCACAGAGAAACGGAAGCATAGCAGGCAACAAAACCAAGAGA AGCCATACAGAGGGATAAGGATGAGGAAGTGGGGTAAGTGGGTAGCAGAAATTAGAGAACCAAACAAGAGGTCTAGGATTTGGCTTGGGTCCTACTCAAC ACCAATAGCTGCAGCTCGTGCATACGACACGGCTGTTTTCTATCTGCGAGGCCCTTCTGCTAGGCTTAATTTCCCTGATTTGATATACCAAGAAGATGAG CTGCGAGATGTGTCTGCTGCTTCTATACGCAAGAAAGCCACTGAAGTTGGGGCTAAAGTGGATGCCTTACAAACCGCTGTCCATGCATCACCAGAAGATA ACTCACGAGTGTTACTTTCAGAGAAACCTGATTTGAACAAGTTCCCAGAAAATTCTGATGAAGAGTGA
AA sequence Show only first row Show all	>Potri.014G025200.3 pacid=42764403 polypeptide=Potri.014G025200.3.p locus=Potri.014G025200 ID=Potri.014G025200.3.v4.1 annot-version=v4.1 MEGGCCTSSTSTPSSTSTATTEKRKHSRQQNQEKPYRGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPSARLNFPDLIYQEDE LRDVSAASIRKKATEVGAKVDALQTAVHASPEDNSRVLLSEKPDLNKFPENSDEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G46768	AP2_ERF	RAP2.1	related to AP2 1 (.1)		Potri.014G025200 [exp]	0	1	DREB36,DREB1.2
AT4G27020			unknown protein		Potri.001G424500 [exp]	2.00	0.9192
AT3G01470	HD	HD-ZIP-1, HAT5,...	HOMEODOMAIN PROTEIN FROM ARABI...		Potri.012G070900 [exp]	2.44	0.9130
AT3G11670		DGD1	DIGALACTOSYL DIACYLGLYCEROL DE...		Potri.006G203200 [exp]	2.44	0.9045
AT3G07790			DGCR14-related (.1)		Potri.014G164200 [exp]	2.44	0.9135
AT2G36220			unknown protein		Potri.016G079500 [exp]	3.87	0.9052
AT5G59050			unknown protein		Potri.009G038600 [exp]	4.00	0.9033
AT5G06280			unknown protein		Potri.016G072500 [exp]	5.65	0.9078
AT3G54540		ABCF4, ATGCN4	ATP-binding cassette F4, gener...		Potri.008G003300 [exp]	7.21	0.8909	GCN4.3
AT4G34630			unknown protein		Potri.009G121700 [exp]	8.24	0.8845
AT3G22750			Protein kinase superfamily pro...		Potri.005G213200 [exp]	11.22	0.8881

Compare expression of checked genes

Potri.014G025200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.