Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44840 130 / 8e-39 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT4G17500 106 / 4e-29 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1) AT5G47220 104 / 1e-28 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT3G23240 98 / 2e-26 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT5G43410 91 / 1e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G23230 90 / 4e-24 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT5G61600 92 / 5e-24 AP2_ERF ERF104 ethylene response factor 104 (.1) AT5G13330 92 / 6e-24 AP2_ERF RAP2.6L related to AP2 6l (.1) AT5G51190 92 / 7e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G33710 91 / 2e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G046700 [exp] 147 / 1e-45 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1) Potri.014G047000 [exp] 137 / 7e-42 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1) Potri.014G046600 [exp] 130 / 4e-39 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1) Potri.014G046900 [exp] 127 / 1e-37 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1) Potri.003G150700 [exp] 114 / 3e-32 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1) Potri.003G081200 [exp] 114 / 4e-32 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1) Potri.001G154100 [exp] 110 / 1e-30 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1) Potri.001G079900 [exp] 110 / 1e-30 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1) Potri.004G051700 [exp] 99 / 4e-27 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016210 [exp] 134 / 2e-40 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1) Lus10016225 [exp] 132 / 6e-40 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1) Lus10029334 [exp] 131 / 1e-39 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1) Lus10016209 [exp] 130 / 4e-39 AT2G44840 148 / 1e-44 ethylene-responsive element binding factor 13 (.1) Lus10029333 [exp] 130 / 4e-39 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1) Lus10016211 [exp] 129 / 9e-39 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1) Lus10016224 [exp] 128 / 3e-38 AT2G44840 143 / 1e-42 ethylene-responsive element binding factor 13 (.1) Lus10016223 [exp] 126 / 6e-38 AT2G44840 144 / 1e-43 ethylene-responsive element binding factor 13 (.1) Lus10029319 [exp] 124 / 3e-37 AT2G44840 142 / 6e-43 ethylene-responsive element binding factor 13 (.1) Lus10029331 [exp] 124 / 1e-36 AT2G44840 147 / 4e-44 ethylene-responsive element binding factor 13 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.014G046800.2 pacid=42762716 polypeptide=Potri.014G046800.2.p locus=Potri.014G046800 ID=Potri.014G046800.2.v4.1 annot-version=v4.1 ATGCAAAGGCAACGGGTTCCTTCGGATCCTAATATTGATTCAGTAACCACTAACACGGTTAGCTATGAGGCTGAGAGAGATGTTGAGGGTGCATCTACCA CAGCACCGAAGGGGAGGAATGATTATAAGGGGGCGAGGAGAAAGCCATGGGAGAAGTATGCGGCAGAGATCAGGGACCCTACGAAGAATGGTGCAAGAAT ATGGCTAGGGACATATGAGACACCTGAGGATGCAGCTTTGGCTTATGACCAAGCTGCTTTTAAGATGCGGGGAGCAAAAGCTAAGCTAGATTTTCCACAT TTGATTGGCTCCATTATTGCTCATCAACCGGTTAGAGTGACTGATAAGCTCTCGTCACCGGAGCCGTCGTAG
AA sequence Show only first row Show all	>Potri.014G046800.2 pacid=42762716 polypeptide=Potri.014G046800.2.p locus=Potri.014G046800 ID=Potri.014G046800.2.v4.1 annot-version=v4.1 MQRQRVPSDPNIDSVTTNTVSYEAERDVEGASTTAPKGRNDYKGARRKPWEKYAAEIRDPTKNGARIWLGTYETPEDAALAYDQAAFKMRGAKAKLDFPH LIGSIIAHQPVRVTDKLSSPEPS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Potri.014G046800 [exp]	0	1
AT1G40390			DNAse I-like superfamily prote...		Potri.004G117750 [exp]	12.44	0.8786
					Potri.004G184650 [exp]	14.14	0.9324
AT5G01750			Protein of unknown function (D...		Potri.016G131100 [exp]	26.49	0.9227
					Potri.006G271692 [exp]	27.54	0.9253
AT1G66200		ATGSR2, GLN1;2	glutamine synthetase 1;2, glut...		Potri.017G138201 [exp]	37.34	0.9238
AT1G62770			Plant invertase/pectin methyle...		Potri.001G119200 [exp]	46.69	0.9142
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Potri.007G100500 [exp]	46.73	0.9216	Pt-NHX8.1
AT5G67360		ARA12	Subtilase family protein (.1)		Potri.004G184600 [exp]	47.37	0.9200
AT1G51120	AP2_ERF		AP2/B3 transcription factor fa...		Potri.006G186301 [exp]	50.82	0.9207
AT4G37560			Acetamidase/Formamidase family...		Potri.007G053750 [exp]	51.43	0.8558

Compare expression of checked genes

Potri.014G046800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.