Potri.014G049600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60270 111 / 7e-31 Cupredoxin superfamily protein (.1)
AT3G60280 109 / 1e-29 UCC3 uclacyanin 3 (.1)
AT5G07475 103 / 1e-27 Cupredoxin superfamily protein (.1)
AT2G32300 98 / 6e-25 UCC1 uclacyanin 1 (.1)
AT2G44790 93 / 2e-23 UCC2 uclacyanin 2 (.1)
AT1G72230 91 / 4e-23 Cupredoxin superfamily protein (.1)
AT2G26720 91 / 7e-23 Cupredoxin superfamily protein (.1)
AT2G31050 90 / 1e-22 Cupredoxin superfamily protein (.1)
AT3G17675 85 / 2e-21 Cupredoxin superfamily protein (.1)
AT1G22480 85 / 8e-21 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G080700 112 / 2e-31 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
Potri.002G101300 110 / 1e-30 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.003G150300 107 / 2e-29 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.002G101200 108 / 3e-29 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.006G067400 98 / 7e-26 AT5G20230 112 / 2e-31 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.007G120200 97 / 1e-24 AT2G32300 118 / 3e-32 uclacyanin 1 (.1)
Potri.018G129400 92 / 1e-23 AT5G20230 114 / 6e-32 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.002G161300 90 / 7e-23 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.006G067300 89 / 2e-21 AT5G20230 97 / 2e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008720 114 / 5e-32 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10020944 114 / 1e-31 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10025580 110 / 2e-30 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10027043 110 / 4e-30 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10012085 107 / 3e-29 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10027143 101 / 1e-26 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10025752 92 / 5e-23 AT5G20230 101 / 1e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Lus10007028 86 / 4e-21 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10007026 86 / 4e-21 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10010533 85 / 1e-20 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.014G049600.1 pacid=42763626 polypeptide=Potri.014G049600.1.p locus=Potri.014G049600 ID=Potri.014G049600.1.v4.1 annot-version=v4.1
ATGGCCAATATTGCATCTGCTCTCCTAATTCTTGTGCTTGCCGCTCCAGCAGCTTATGCTGCTACAACGTACACTGTTGGTGACTCGTCCGGCTGGAGTA
CCACGTTCGGAGATTACACCACTTGGGTTAGTGGTAAAACATTCACTGTTGGTGACTCTCTTCTGTTCAAGTATAGCTCCACACACACTGTGGCTGAAGT
ATCGAAAGGCGACTACGATAGTTGCAGCACGAGTAATCTCGGGAAAACCTATACTGATGGAAGCTCAACAGTACCCTTGTCCACGGCTGGTCCAATGTAC
TTCATTTGTCCCACATCTGGTCACTGTTCCGGCGGCATGAAGCTAGCAATCACCGTTGTCGCAGCCAGTGGCACCCCAAGTACCCCCACCACACCTCCAG
TCGACGATGGTTCAACCACTCCACCAACTACATCTGGCTCGCCACCTACAACCCCATCAACCACCGTCACACCACCACCACCATCGAAGAGTAATAATGG
AGCCACCAGCATTTTATATAACATGATGCTTGGTGTCTTTCTTGTATTCGGAACAACTGTTGCATTGATGGGCCAGTGA
AA sequence
>Potri.014G049600.1 pacid=42763626 polypeptide=Potri.014G049600.1.p locus=Potri.014G049600 ID=Potri.014G049600.1.v4.1 annot-version=v4.1
MANIASALLILVLAAPAAYAATTYTVGDSSGWSTTFGDYTTWVSGKTFTVGDSLLFKYSSTHTVAEVSKGDYDSCSTSNLGKTYTDGSSTVPLSTAGPMY
FICPTSGHCSGGMKLAITVVAASGTPSTPTTPPVDDGSTTPPTTSGSPPTTPSTTVTPPPPSKSNNGATSILYNMMLGVFLVFGTTVALMGQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G60270 Cupredoxin superfamily protein... Potri.014G049600 0 1
AT5G67400 RHS19 root hair specific 19 (.1) Potri.017G064100 2.64 0.8210
Potri.002G070101 4.00 0.7670
AT1G21460 SWEET1, AtSWEET... Nodulin MtN3 family protein (.... Potri.002G072600 8.66 0.7019
AT4G33790 G7, FAR3, CER4 FATTY ACID REDUCTASE 3, ECERIF... Potri.009G145000 16.85 0.7027
AT3G12830 SAUR-like auxin-responsive pro... Potri.007G067800 34.69 0.6072
AT1G80580 AP2_ERF Integrase-type DNA-binding sup... Potri.017G053700 40.39 0.6024
AT5G40990 GLIP1 GDSL lipase 1 (.1) Potri.013G065100 69.57 0.6246
AT1G14590 Nucleotide-diphospho-sugar tra... Potri.012G037300 73.49 0.6526
Potri.007G103500 110.99 0.5868
AT2G05940 RIPK RPM1-induced protein kinase, P... Potri.006G219300 110.99 0.6150

Potri.014G049600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.