Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	CPC.2,MYB217
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46410 115 / 7e-35 MYB CPC CAPRICE, Homeodomain-like superfamily protein (.1) AT5G53200 114 / 3e-34 MYB TRY TRIPTYCHON, Homeodomain-like superfamily protein (.1) AT4G01060 99 / 9e-29 MYB CPL3, ETC3 ENHANCER OF TRY AND CPC 3, CAPRICE-like MYB3 (.1.2.3) AT2G30420 97 / 1e-27 MYB ETC2 ENHANCER OF TRY AND CPC 2, Homeodomain-like superfamily protein (.1) AT2G30424 96 / 2e-27 MYB TCL2 TRICHOMELESS 2, Homeodomain-like superfamily protein (.1) AT2G30432 91 / 2e-25 MYB TCL1 TRICHOMELESS1, Homeodomain-like superfamily protein (.1) AT1G01380 72 / 4e-18 MYB ETC1 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) AT5G52600 61 / 2e-12 MYB AtMYB82 myb domain protein 82 (.1) AT5G14750 59 / 8e-12 MYB WER1, WER, AtMYB66 WEREWOLF 1, WEREWOLF, myb domain protein 66 (.1) AT3G27920 59 / 1e-11 MYB GL1, ATMYB0, AtGL1 GLABRA 1, myb domain protein 0 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G168900 [exp] 172 / 3e-57 AT5G53200 122 / 2e-37 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.012G031200 [exp] 101 / 1e-28 AT5G53200 102 / 6e-29 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.015G022000 [exp] 99 / 2e-28 AT5G53200 104 / 2e-30 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.007G122800 [exp] 70 / 3e-17 AT2G46410 69 / 3e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.017G037000 [exp] 69 / 5e-17 AT2G46410 69 / 4e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.011G026300 [exp] 69 / 1e-16 AT1G01380 68 / 9e-17 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) Potri.004G021300 [exp] 68 / 2e-16 AT1G01380 67 / 1e-16 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) Potri.004G015100 [exp] 66 / 1e-15 AT2G46410 71 / 1e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.001G169600 [exp] 63 / 1e-13 AT5G14750 167 / 9e-53 WEREWOLF 1, WEREWOLF, myb domain protein 66 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005949 [exp] 93 / 4e-26 AT4G01060 91 / 2e-25 ENHANCER OF TRY AND CPC 3, CAPRICE-like MYB3 (.1.2.3) Lus10038822 [exp] 85 / 5e-23 AT5G53200 96 / 1e-27 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Lus10014933 [exp] 82 / 4e-22 AT2G46410 96 / 1e-27 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10038092 [exp] 64 / 1e-13 AT5G52600 185 / 1e-58 myb domain protein 82 (.1) Lus10006647 [exp] 64 / 1e-13 AT5G52600 186 / 6e-59 myb domain protein 82 (.1) Lus10018366 [exp] 62 / 2e-13 AT2G46410 67 / 2e-15 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10007643 [exp] 60 / 3e-13 AT2G46410 65 / 3e-15 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10018414 [exp] 64 / 5e-13 AT4G05120 548 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10033438 [exp] 61 / 2e-12 AT1G22640 194 / 2e-61 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1) Lus10001043 [exp] 60 / 2e-12 AT1G22640 119 / 1e-33 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Potri.014G096300.1 pacid=42762958 polypeptide=Potri.014G096300.1.p locus=Potri.014G096300 ID=Potri.014G096300.1.v4.1 annot-version=v4.1 ATGGATAGGCGTCGCAAGAAGCAAGCCAAGACTACATCTTGTTGTTCTGAACAAGCTAATTCACCACTCCTGCTCTGTAATAATTTGGCAGAGGTGAGCA GCATTGAGTGGGAGTTCATTAACATGTCAGAACAAGAAGAAGATCTCATTTACAGAATGCATAATCTGGTGGGGGACAGGTGGGCTTTGATCGCTGGTCG AATTCCAGGACGCAAAGCTGAAGAAATAGAGAGATTTTGGCTAATGAGACACGGTGAAGGGTTTGCCAGTCGACGAAGAGAGCAAAAGAGATGTCATTCC TAA
AA sequence Show only first row Show all	>Potri.014G096300.1 pacid=42762958 polypeptide=Potri.014G096300.1.p locus=Potri.014G096300 ID=Potri.014G096300.1.v4.1 annot-version=v4.1 MDRRRKKQAKTTSCCSEQANSPLLLCNNLAEVSSIEWEFINMSEQEEDLIYRMHNLVGDRWALIAGRIPGRKAEEIERFWLMRHGEGFASRRREQKRCHS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46410	MYB	CPC	CAPRICE, Homeodomain-like supe...		Potri.014G096300 [exp]	0	1	CPC.2,MYB217
AT5G62200			Embryo-specific protein 3, (AT...		Potri.012G130900 [exp]	3.16	0.8349
AT2G36540			Haloacid dehalogenase-like hyd...		Potri.010G244200 [exp]	4.35	0.8627
AT1G72830	CCAAT	NF-YA3, ATHAP2C...	"nuclear factor Y, subunit A3"...		Potri.018G064700 [exp]	8.06	0.7945
AT1G62510			Bifunctional inhibitor/lipid-t...		Potri.003G111400 [exp]	16.24	0.7629
					Potri.001G075201 [exp]	16.73	0.7904
AT1G70210		ATCYCD1;1, CYCD...	CYCLIN D1;1 (.1)		Potri.008G146600 [exp]	20.49	0.7883	CYCD1.2
AT4G00950		MEE47	maternal effect embryo arrest ...		Potri.014G100200 [exp]	21.65	0.7908
AT1G21980		ATPIPK1, ATPIP5...	phosphatidylinositol-4-phospha...		Potri.019G015768 [exp]	26.26	0.7943
					Potri.012G102100 [exp]	27.65	0.7531
AT5G45540			Protein of unknown function (D...		Potri.015G114101 [exp]	28.53	0.7896

Compare expression of checked genes

Potri.014G096300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.