Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	GRP2.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27720 176 / 7e-58 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) AT1G20580 60 / 5e-12 Small nuclear ribonucleoprotein family protein (.1) AT1G76300 57 / 4e-11 SMD3 snRNP core protein SMD3 (.1) AT3G59810 41 / 3e-05 Small nuclear ribonucleoprotein family protein (.1) AT4G02840 41 / 4e-05 Small nuclear ribonucleoprotein family protein (.1.2) AT3G07590 39 / 0.0002 Small nuclear ribonucleoprotein family protein (.1.2) AT2G43810 38 / 0.0003 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G205700 [exp] 192 / 7e-64 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.002G010200 [exp] 60 / 4e-12 AT1G20580 214 / 5e-73 Small nuclear ribonucleoprotein family protein (.1) Potri.005G251100 [exp] 59 / 6e-12 AT1G20580 211 / 6e-72 Small nuclear ribonucleoprotein family protein (.1) Potri.008G078400 [exp] 40 / 3e-05 AT2G43810 166 / 2e-55 Small nuclear ribonucleoprotein family protein (.1.2) Potri.002G054800 [exp] 41 / 4e-05 AT3G07590 183 / 1e-61 Small nuclear ribonucleoprotein family protein (.1.2) Potri.010G178700 [exp] 40 / 4e-05 AT2G43810 150 / 4e-49 Small nuclear ribonucleoprotein family protein (.1.2) Potri.018G092200 [exp] 37 / 0.0004 AT4G30220 155 / 2e-51 small nuclear ribonucleoprotein F (.1.2) Potri.005G207900 [exp] 37 / 0.0007 AT4G02840 152 / 3e-49 Small nuclear ribonucleoprotein family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004221 [exp] 177 / 2e-55 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 176 / 3e-53 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10016013 [exp] 59 / 2e-11 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10012263 [exp] 59 / 2e-11 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10030747 [exp] 59 / 2e-11 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10013227 [exp] 59 / 2e-11 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10025186 [exp] 42 / 2e-05 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2) Lus10016068 [exp] 42 / 2e-05 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2) Lus10028022 [exp] 42 / 2e-05 AT3G07590 181 / 1e-60 Small nuclear ribonucleoprotein family protein (.1.2) Lus10003727 [exp] 42 / 6e-05 AT3G07590 180 / 1e-58 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.014G130700.1 pacid=42764620 polypeptide=Potri.014G130700.1.p locus=Potri.014G130700 ID=Potri.014G130700.1.v4.1 annot-version=v4.1 ATGCTTCCTCTTTCTCTACTTAAGACTGCTCAAGGCCACCCTATGTTGGTGGAACTGAAAAATGGAGAGACTTATAATGGGCATTTGGTCAATTGTGATA CTTGGATGAACATCCATCTCCGTGAAGTCATCTGCACCTCCAAGGATGGAGATAGGTTTTGGCGAACGCCTGAATGCTACATTCGTGGGAATACTATCAA GTATCTTCGAGTTCCTGATGAGGTAATTGATAAAGTTCAAGAAGAAACCAAGAGTCGCTCAGATCGGAAGCCACCAGGGGTGGGGCGTGGAAGAGGAAGA GGTAGAGAAGATGGTCCCGGTGGAAGGCCAGCAAAAGGGATTGGGCGTGGCCTTGCTGATGATGGAGGTCCCAAGGGCATGGGTGGTGGCCGTGGTAGAG GTGGTCCAGGTGGAAAGACTGGTGGGAGCAGAGGTGCAGGGCGAGGCCGAGGTTAA
AA sequence Show only first row Show all	>Potri.014G130700.1 pacid=42764620 polypeptide=Potri.014G130700.1.p locus=Potri.014G130700 ID=Potri.014G130700.1.v4.1 annot-version=v4.1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRTPECYIRGNTIKYLRVPDEVIDKVQEETKSRSDRKPPGVGRGRGR GREDGPGGRPAKGIGRGLADDGGPKGMGGGRGRGGPGGKTGGSRGAGRGRG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Potri.014G130700 [exp]	0	1	GRP2.2
AT5G09680		RLF	reduced lateral root formation...		Potri.001G263800 [exp]	1.00	0.8168
AT1G01050		ATPPA1	pyrophosphorylase 1 (.1)		Potri.007G022700 [exp]	19.79	0.7444
AT1G45000			AAA-type ATPase family protein...		Potri.009G120500 [exp]	21.07	0.7195
AT3G06483		ATPDHK, PDK	pyruvate dehydrogenase kinase ...		Potri.010G002000 [exp]	21.97	0.7463	Pt-PDK.1
AT3G07170			Sterile alpha motif (SAM) doma...		Potri.002G244700 [exp]	27.12	0.7052
AT4G38130		ATHDA19, ATHD1,...	ARABIDOPSIS HISTONE DEACETYLAS...		Potri.004G209800 [exp]	31.30	0.6968	RPD3.2
AT2G17390		AKR2B	ankyrin repeat-containing 2B (...		Potri.004G210100 [exp]	34.59	0.7279
AT4G37210			Tetratricopeptide repeat (TPR)...		Potri.007G034200 [exp]	37.09	0.6554
AT5G17840			DnaJ/Hsp40 cysteine-rich domai...		Potri.019G040400 [exp]	42.42	0.7107
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Potri.005G232700 [exp]	42.49	0.7286

Compare expression of checked genes

Potri.014G130700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.