Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48940 163 / 1e-51 AtENODL6 early nodulin-like protein 6 (.1) AT3G18590 158 / 1e-49 AtENODL5 early nodulin-like protein 5 (.1) AT5G14345 114 / 1e-32 AtENODL21 early nodulin-like protein 21 (.1) AT2G25060 113 / 5e-32 AtENODL14 early nodulin-like protein 14 (.1) AT4G28365 110 / 2e-30 AtENODL3 early nodulin-like protein 3 (.1) AT1G79800 105 / 1e-28 AtENODL7 early nodulin-like protein 7 (.1) AT4G31840 103 / 3e-28 AtENODL15 early nodulin-like protein 15 (.1) AT4G32490 102 / 3e-27 AtENODL4 early nodulin-like protein 4 (.1) AT5G53870 94 / 6e-23 AtENODL1 early nodulin-like protein 1 (.1) AT2G31050 90 / 1e-22 Cupredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G338800 [exp] 149 / 4e-46 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1) Potri.001G187700 [exp] 112 / 9e-32 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1) Potri.015G113300 [exp] 110 / 2e-31 AT5G14345 110 / 9e-32 early nodulin-like protein 21 (.1) Potri.011G117800 [exp] 109 / 5e-29 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1) Potri.017G011200 [exp] 105 / 1e-28 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1) Potri.003G050500 [exp] 103 / 8e-28 AT1G79800 162 / 1e-50 early nodulin-like protein 7 (.1) Potri.006G184100 [exp] 102 / 1e-27 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1) Potri.006G264600 [exp] 101 / 2e-27 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1) Potri.001G398800 [exp] 105 / 4e-27 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009617 [exp] 149 / 5e-46 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1) Lus10022318 [exp] 141 / 1e-42 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1) Lus10014880 [exp] 137 / 4e-41 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1) Lus10032111 [exp] 135 / 2e-40 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1) Lus10026880 [exp] 102 / 2e-27 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1) Lus10003432 [exp] 101 / 4e-27 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1) Lus10018617 [exp] 99 / 8e-26 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1) Lus10039852 [exp] 94 / 3e-24 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1) Lus10009196 [exp] 93 / 7e-23 AT5G53870 154 / 3e-44 early nodulin-like protein 1 (.1) Lus10018758 [exp] 88 / 7e-22 AT1G79800 142 / 2e-43 early nodulin-like protein 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.015G052000.1 pacid=42775102 polypeptide=Potri.015G052000.1.p locus=Potri.015G052000 ID=Potri.015G052000.1.v4.1 annot-version=v4.1 ATGGCATCTGATCTCTTCAATGGTTCATGCAAAGTCTTCCTCTCGTTGATTATCTTCTCCTCCATTTTTCAGTTCTGCTTTGTTATTTCCACCGAGTTTC TTGTAGGAGGTCAGGATGGTTGGACTATTCCTAAGAAAGATAGCCAAATGTACATTGACTGGGCCTCCAAAAATAGGTTTAAAGTTGACGACACCGTTCA ATTCAAGTACAACAAAGACTCAGTTTTGGTAGTGACTGAGGAAGAGTACCAAAAATGCCGATCTGCTCATCCCTTATTCTTCTCCAACAATGGGGACTCT GTTTTCAAGTTGGACCGACCTGGTTTGTTCTATTTCATCAGTGGAGTTGCTGGGCATTGTGAGAGAGGGCAGAAGATGATCATCAAAGTGTTGGAGCTAG AAACCCCACCCCAGTCCGCAAATGACACCAGCCCACCAGATCATACCAATAAGAAAAATGGTGCTGTTCAAATGCCTCCTGCCATTATACCACCCATCAT CGTTCTTCCTAGCTTGTTTTTTCTAGGTTTTCTCTTTGTTTAA
AA sequence Show only first row Show all	>Potri.015G052000.1 pacid=42775102 polypeptide=Potri.015G052000.1.p locus=Potri.015G052000 ID=Potri.015G052000.1.v4.1 annot-version=v4.1 MASDLFNGSCKVFLSLIIFSSIFQFCFVISTEFLVGGQDGWTIPKKDSQMYIDWASKNRFKVDDTVQFKYNKDSVLVVTEEEYQKCRSAHPLFFSNNGDS VFKLDRPGLFYFISGVAGHCERGQKMIIKVLELETPPQSANDTSPPDHTNKKNGAVQMPPAIIPPIIVLPSLFFLGFLFV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G48940		AtENODL6	early nodulin-like protein 6 (...		Potri.015G052000 [exp]	0	1
AT5G56510		APUM12	pumilio 12 (.1)		Potri.001G298000 [exp]	18.24	1.0000
AT1G52900			Toll-Interleukin-Resistance (T...		Potri.001G403800 [exp]	22.75	1.0000
AT1G55790			Domain of unknown function (DU...		Potri.001G438200 [exp]	25.07	1.0000
					Potri.001G276804 [exp]	29.66	1.0000
					Potri.001G330250 [exp]	33.16	1.0000
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Potri.005G111800 [exp]	38.47	1.0000
AT5G44840			Pectin lyase-like superfamily ...		Potri.006G252900 [exp]	42.57	1.0000
					Potri.001G466250 [exp]	45.71	1.0000
					Potri.013G052950 [exp]	52.67	1.0000
AT2G16430		ATPAP10, PAP10	purple acid phosphatase 10 (.1...		Potri.004G160200 [exp]	58.39	1.0000

Compare expression of checked genes

Potri.015G052000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.