Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50770 104 / 9e-28 ATHSD6 hydroxysteroid dehydrogenase 6 (.1) AT5G50700 104 / 1e-27 HSD1 hydroxysteroid dehydrogenase 1 (.1) AT5G50600 104 / 1e-27 ATHSD1 hydroxysteroid dehydrogenase 1 (.1) AT3G47350 100 / 2e-26 ATHSD2 hydroxysteroid dehydrogenase 2 (.1.2) AT3G47360 100 / 4e-26 ATHSD3 hydroxysteroid dehydrogenase 3 (.1) AT5G50690 90 / 3e-22 ATHSD7 hydroxysteroid dehydrogenase 7 (.1) AT5G50590 90 / 3e-22 ATHSD4 hydroxysteroid dehydrogenase 4 (.1) AT4G10020 83 / 2e-19 ATHSD5 hydroxysteroid dehydrogenase 5 (.1) AT3G12800 53 / 8e-09 SDRB, DECR short-chain dehydrogenase-reductase B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G099900 [exp] 109 / 7e-30 AT5G50700 285 / 5e-95 hydroxysteroid dehydrogenase 1 (.1) Potri.015G100000 [exp] 108 / 3e-29 AT5G50690 298 / 8e-101 hydroxysteroid dehydrogenase 7 (.1) Potri.012G101900 [exp] 102 / 7e-27 AT5G50690 287 / 9e-97 hydroxysteroid dehydrogenase 7 (.1) Potri.016G048900 [exp] 98 / 4e-25 AT5G50690 275 / 2e-91 hydroxysteroid dehydrogenase 7 (.1) Potri.016G048800 [exp] 96 / 2e-24 AT5G50690 284 / 2e-95 hydroxysteroid dehydrogenase 7 (.1) Potri.013G100200 [exp] 79 / 3e-18 AT4G10020 506 / 0.0 hydroxysteroid dehydrogenase 5 (.1) Potri.019G073200 [exp] 77 / 2e-17 AT4G10020 494 / 4e-176 hydroxysteroid dehydrogenase 5 (.1) Potri.012G125900 [exp] 50 / 9e-08 AT3G12800 421 / 9e-150 short-chain dehydrogenase-reductase B (.1) Potri.006G025400 [exp] 49 / 1e-07 AT3G12800 427 / 3e-152 short-chain dehydrogenase-reductase B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016748 [exp] 111 / 2e-29 AT5G50770 360 / 4e-122 hydroxysteroid dehydrogenase 6 (.1) Lus10022441 [exp] 108 / 5e-29 AT5G50770 349 / 3e-120 hydroxysteroid dehydrogenase 6 (.1) Lus10032556 [exp] 105 / 6e-28 AT5G50600 411 / 4e-144 hydroxysteroid dehydrogenase 1 (.1) Lus10043187 [exp] 100 / 3e-26 AT5G50600 404 / 4e-141 hydroxysteroid dehydrogenase 1 (.1) Lus10031448 [exp] 96 / 4e-24 AT5G50600 378 / 3e-131 hydroxysteroid dehydrogenase 1 (.1) Lus10001511 [exp] 95 / 6e-24 AT5G50600 388 / 5e-135 hydroxysteroid dehydrogenase 1 (.1) Lus10006178 [exp] 77 / 3e-17 AT4G10020 485 / 8e-173 hydroxysteroid dehydrogenase 5 (.1) Lus10022442 [exp] 76 / 4e-17 AT3G47350 282 / 1e-94 hydroxysteroid dehydrogenase 2 (.1.2) Lus10041045 [exp] 76 / 5e-17 AT4G10020 506 / 3e-180 hydroxysteroid dehydrogenase 5 (.1) Lus10001280 [exp] 76 / 6e-17 AT4G10020 495 / 5e-176 hydroxysteroid dehydrogenase 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF00106 [poplar] [flax] adh_short short chain dehydrogenase
Representative CDS sequence Show only first row Show all	>Potri.015G100102.1 pacid=42775268 polypeptide=Potri.015G100102.1.p locus=Potri.015G100102 ID=Potri.015G100102.1.v4.1 annot-version=v4.1 ATGGAAGTCTCTAGCATAGCATTTGAGTATGCTGGGAGAGGAGCTTGTATAGCCCTTGTTGCAAGAAGAAAGGAACGTCTGATACAAGTCGCTGCCATGG CTGAGCTGATTGGATCACCTGAAGCTATTTTTATCCCTGGAGATGTTACCAAGGACGAAGATTGTGAAAGATTTATAGATGCAACAGTGAAGCACTTTGG TCACTTGGATCATCTGGTGGCCAACGCTGGGGTTGCAACAGTGGGCGTGTTCGAAGACGCCCATGATGTCACTCCTTTTGCACCAGCCATACAAAGACAT AAACTTCTGGGGCTCAGTGTATTGTACCTACTTTGCAATTCCGCACTTAAAAAGGAAAAATTGAAGGATCGTAGTAGTTGCTTCAGTTGCCGCATTTCTA CCTATCCCAAGACTAAGCTTCTATAA
AA sequence Show only first row Show all	>Potri.015G100102.1 pacid=42775268 polypeptide=Potri.015G100102.1.p locus=Potri.015G100102 ID=Potri.015G100102.1.v4.1 annot-version=v4.1 MEVSSIAFEYAGRGACIALVARRKERLIQVAAMAELIGSPEAIFIPGDVTKDEDCERFIDATVKHFGHLDHLVANAGVATVGVFEDAHDVTPFAPAIQRH KLLGLSVLYLLCNSALKKEKLKDRSSCFSCRISTYPKTKLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G50770		ATHSD6	hydroxysteroid dehydrogenase 6...		Potri.015G100102 [exp]	0	1
AT5G24090		ATCHIA	chitinase A (.1)		Potri.014G092932 [exp]	1.00	0.9349
AT3G60130		BGLU16	beta glucosidase 16 (.1.2.3)		Potri.001G226200 [exp]	2.82	0.9311	Pt-PLIN-GEN.19
AT5G05960			Bifunctional inhibitor/lipid-t...		Potri.010G196300 [exp]	2.82	0.9303
AT5G25820			Exostosin family protein (.1)		Potri.006G239000 [exp]	4.00	0.8455
					Potri.010G169350 [exp]	4.12	0.8431
AT2G31335			unknown protein		Potri.019G012400 [exp]	5.47	0.9004
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.008G180400 [exp]	5.91	0.8839
					Potri.001G306932 [exp]	6.70	0.8806
AT4G17220		ATMAP70-5	microtubule-associated protein...		Potri.016G006900 [exp]	7.74	0.8794
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Potri.001G225812 [exp]	8.48	0.8412

Compare expression of checked genes

Potri.015G100102 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.