Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14345 97 / 2e-26 AtENODL21 early nodulin-like protein 21 (.1) AT3G18590 88 / 2e-22 AtENODL5 early nodulin-like protein 5 (.1) AT1G48940 86 / 2e-21 AtENODL6 early nodulin-like protein 6 (.1) AT4G31840 59 / 2e-11 AtENODL15 early nodulin-like protein 15 (.1) AT3G20570 59 / 6e-11 AtENODL9 early nodulin-like protein 9 (.1) AT4G28365 57 / 1e-10 AtENODL3 early nodulin-like protein 3 (.1) AT2G25060 56 / 4e-10 AtENODL14 early nodulin-like protein 14 (.1) AT1G79800 52 / 1e-08 AtENODL7 early nodulin-like protein 7 (.1) AT4G32490 48 / 3e-07 AtENODL4 early nodulin-like protein 4 (.1) AT1G64640 48 / 4e-07 AtENODL8 early nodulin-like protein 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G113300 [exp] 224 / 2e-76 AT5G14345 110 / 9e-32 early nodulin-like protein 21 (.1) Potri.001G338800 [exp] 166 / 5e-53 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1) Potri.015G052000 [exp] 97 / 7e-26 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1) Potri.018G018200 [exp] 57 / 2e-10 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1) Potri.006G184100 [exp] 55 / 1e-09 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1) Potri.006G264600 [exp] 54 / 2e-09 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1) Potri.001G419200 [exp] 51 / 4e-08 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1) Potri.001G187700 [exp] 50 / 4e-08 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1) Potri.011G135400 [exp] 50 / 6e-08 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022318 [exp] 134 / 5e-40 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1) Lus10014880 [exp] 122 / 9e-36 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1) Lus10032111 [exp] 116 / 3e-33 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1) Lus10009617 [exp] 75 / 5e-17 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1) Lus10014575 [exp] 74 / 1e-15 AT5G40640 714 / 0.0 unknown protein Lus10011158 [exp] 59 / 6e-11 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1) Lus10043063 [exp] 56 / 6e-10 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1) Lus10003432 [exp] 51 / 2e-08 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1) Lus10026880 [exp] 49 / 1e-07 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1) Lus10018758 [exp] 48 / 5e-07 AT1G79800 142 / 2e-43 early nodulin-like protein 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.015G114600.2 pacid=42776040 polypeptide=Potri.015G114600.2.p locus=Potri.015G114600 ID=Potri.015G114600.2.v4.1 annot-version=v4.1 ATGGCGGTCATTTTCACTTCTCTTCGATACTTATCGGTGTATTCCTTTGAATACCAAATTGGCGGAAACGAAAACTTGGTTGTCCCTCCCGCCATTGATA CCAGAATCTACGTTGACTGGGCCTTAGAGAACCGATTCCAAGTTGGTGATACAGCTCGTGATCAGTTCAAACACAAAGAAATACGAGATCTGCCTTTACC TTCAATTTCCTGGGTGTTCATCATCTTTTTTTGCGAAGGTTTCAAGCACAGGAAGGATTCCGTGATGAAGGTTAGGGCAGAGGATTACAAGAAGCGCAAC TCCCGTCACCCCAACTTCTTTTCCAACACTGTTCACCATCTTAATCATCCAGCGTCTTCCTACTTCATAAGTGGGGTTTCTGGACACTGCGAGAAGGGAC AAAGGATGATCATCATTAAGGTTATCTCAACTGATCAAGAGACTAATTCAAATCTGCAGCTTTTCCTTCTGCAGGAGTGCTAG
AA sequence Show only first row Show all	>Potri.015G114600.2 pacid=42776040 polypeptide=Potri.015G114600.2.p locus=Potri.015G114600 ID=Potri.015G114600.2.v4.1 annot-version=v4.1 MAVIFTSLRYLSVYSFEYQIGGNENLVVPPAIDTRIYVDWALENRFQVGDTARDQFKHKEIRDLPLPSISWVFIIFFCEGFKHRKDSVMKVRAEDYKKRN SRHPNFFSNTVHHLNHPASSYFISGVSGHCEKGQRMIIIKVISTDQETNSNLQLFLLQEC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G14345		AtENODL21	early nodulin-like protein 21 ...		Potri.015G114600 [exp]	0	1
AT1G32440		PKP3	plastidial pyruvate kinase 3 (...		Potri.001G145300 [exp]	4.69	0.7614
AT3G12650			unknown protein		Potri.001G269000 [exp]	20.04	0.8136
AT4G39620		ATPPR5, EMB2453	EMBRYO DEFECTIVE 2453, A. THAL...		Potri.007G084750 [exp]	23.32	0.7812
AT1G72830	CCAAT	NF-YA3, ATHAP2C...	"nuclear factor Y, subunit A3"...		Potri.006G145100 [exp]	29.46	0.7686	HAP2.6
AT5G64820			unknown protein		Potri.005G085000 [exp]	44.49	0.7634
AT3G20898			unknown protein		Potri.001G257700 [exp]	53.51	0.7529
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Potri.003G202100 [exp]	53.67	0.7300
AT5G10970	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Potri.003G180600 [exp]	55.31	0.7291
AT5G55490		GEX1, ATGEX1	gamete expressed protein 1 (.1...		Potri.017G137100 [exp]	58.13	0.6873
AT1G10020			Protein of unknown function (D...		Potri.002G112600 [exp]	65.48	0.7375

Compare expression of checked genes

Potri.015G114600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.