Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27200 74 / 6e-17 Cupredoxin superfamily protein (.1) AT2G32300 71 / 4e-15 UCC1 uclacyanin 1 (.1) AT4G27520 67 / 2e-13 AtENODL2 early nodulin-like protein 2 (.1) AT2G26720 66 / 2e-13 Cupredoxin superfamily protein (.1) AT2G25060 64 / 5e-13 AtENODL14 early nodulin-like protein 14 (.1) AT3G17675 62 / 5e-13 Cupredoxin superfamily protein (.1) AT5G26330 61 / 7e-12 Cupredoxin superfamily protein (.1) AT5G53870 62 / 1e-11 AtENODL1 early nodulin-like protein 1 (.1) AT4G31840 61 / 1e-11 AtENODL15 early nodulin-like protein 15 (.1) AT1G45063 61 / 2e-11 copper ion binding;electron carriers (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G009000 [exp] 251 / 3e-86 AT2G32300 77 / 3e-17 uclacyanin 1 (.1) Potri.001G332200 [exp] 71 / 2e-15 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1) Potri.003G150300 [exp] 71 / 2e-15 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1) Potri.001G080700 [exp] 66 / 9e-14 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1) Potri.014G049600 [exp] 65 / 3e-13 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1) Potri.003G047300 [exp] 64 / 2e-12 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.010G089900 [exp] 63 / 2e-12 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1) Potri.007G120200 [exp] 62 / 5e-12 AT2G32300 118 / 3e-32 uclacyanin 1 (.1) Potri.003G183300 [exp] 61 / 1e-11 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010484 [exp] 140 / 3e-42 AT2G32300 87 / 6e-21 uclacyanin 1 (.1) Lus10003799 [exp] 86 / 6e-22 AT2G32300 49 / 1e-07 uclacyanin 1 (.1) Lus10022350 [exp] 77 / 5e-18 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1) Lus10041570 [exp] 76 / 1e-17 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1) Lus10027043 [exp] 67 / 4e-14 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10027143 [exp] 67 / 9e-14 AT2G32300 137 / 9e-40 uclacyanin 1 (.1) Lus10025580 [exp] 66 / 2e-13 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1) Lus10008720 [exp] 60 / 3e-11 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1) Lus10012085 [exp] 58 / 1e-10 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1) Lus10019955 [exp] 57 / 3e-10 AT4G30590 120 / 1e-34 early nodulin-like protein 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.016G015200.2 pacid=42810615 polypeptide=Potri.016G015200.2.p locus=Potri.016G015200 ID=Potri.016G015200.2.v4.1 annot-version=v4.1 ATGGCAATGACCAAGAAGATATTGATGGTTCTGGTTCTGGTTCTAGTCCTAGTGAGCCTTAATGATGGAGCCCAGGTGCACCATGTAGTTGGAGGGGATC GTGGATGGCACCCTTATTCTGATATTGGTTCTTGGTCCTCTGCTAGAACTTTCAGAGTTGGAGATAAAATTTGGTTCACCCACTCTGCAGCACAGGGTAG GATAGCTGAGGTAGAGACAAAGGAAGAATATCTAACGTGTGATGTGAGCAATCCAATCAGAATGTACACTGATGACAGTGATGGCATCACTCTTGATGGA GAAGGGGTCCGTTACTTCACAAGCAGCAGTTCTGACAAGTGCAAGAATGGCCTGAAATTACATGTAGAGGTGGTGGTTCCTGAAGCCAGAACTGATACCA CCACCGCACAAGTCGCATCAGAAGGCTCAGATAAGGCTATTGCTGCCCCACCAGAAAGTTCAGCTCCATCCCATTTCGGTGCAAGCTTTGCTTTATTGAT GGCTGGATTTTGGTTGTCCTATATGGGCATTTAG
AA sequence Show only first row Show all	>Potri.016G015200.2 pacid=42810615 polypeptide=Potri.016G015200.2.p locus=Potri.016G015200 ID=Potri.016G015200.2.v4.1 annot-version=v4.1 MAMTKKILMVLVLVLVLVSLNDGAQVHHVVGGDRGWHPYSDIGSWSSARTFRVGDKIWFTHSAAQGRIAEVETKEEYLTCDVSNPIRMYTDDSDGITLDG EGVRYFTSSSSDKCKNGLKLHVEVVVPEARTDTTTAQVASEGSDKAIAAPPESSAPSHFGASFALLMAGFWLSYMGI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G27200			Cupredoxin superfamily protein...		Potri.016G015200 [exp]	0	1
AT1G45688			unknown protein		Potri.001G183600 [exp]	2.44	0.8095
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Potri.003G139200 [exp]	3.16	0.8320
AT5G37780		ACAM-1, TCH1, C...	TOUCH 1, calmodulin 1 (.1.2.3)		Potri.012G041000 [exp]	5.00	0.7669	Pt-ACCAL.2
AT2G47115			unknown protein		Potri.014G115200 [exp]	7.34	0.8250
AT2G27770			Plant protein of unknown funct...		Potri.004G187600 [exp]	9.53	0.7949
AT3G56950		SIP2;1, SIP2	small and basic intrinsic prot...		Potri.006G027200 [exp]	9.89	0.7423	Pt-SIP2.2
AT3G22060			Receptor-like protein kinase-r...		Potri.017G040300 [exp]	15.62	0.8066
AT5G38530		TSBtype2	tryptophan synthase beta type ...		Potri.017G109600 [exp]	18.00	0.7919
AT1G11820			O-Glycosyl hydrolases family 1...		Potri.011G006100 [exp]	19.41	0.7808
AT2G16760			Calcium-dependent phosphotries...		Potri.014G120300 [exp]	21.90	0.7886

Compare expression of checked genes

Potri.016G015200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.