Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11500 152 / 4e-50 Small nuclear ribonucleoprotein family protein (.1) AT2G23930 149 / 5e-49 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2) AT2G03870 57 / 5e-12 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) AT3G14080 53 / 2e-10 Small nuclear ribonucleoprotein family protein (.1.2) AT1G19120 50 / 2e-09 Small nuclear ribonucleoprotein family protein (.1) AT3G59810 37 / 0.0002 Small nuclear ribonucleoprotein family protein (.1) AT1G65700 36 / 0.0003 Small nuclear ribonucleoprotein family protein (.1.2.3) AT5G44500 36 / 0.0008 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G211100 [exp] 155 / 1e-51 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.001G269500 [exp] 57 / 4e-12 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.009G064000 [exp] 57 / 4e-12 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.003G068400 [exp] 52 / 4e-10 AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G166600 [exp] 52 / 8e-10 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G278000 [exp] 39 / 5e-05 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.001G440100 [exp] 37 / 0.0004 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.011G155700 [exp] 37 / 0.0005 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017019 [exp] 151 / 9e-50 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10021342 [exp] 150 / 2e-49 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1) Lus10035639 [exp] 55 / 2e-11 AT2G03870 179 / 3e-60 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Lus10008124 [exp] 52 / 6e-10 AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) Lus10013108 [exp] 39 / 0.0001 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2) Lus10042884 [exp] 37 / 0.0002 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.016G078100.1 pacid=42810617 polypeptide=Potri.016G078100.1.p locus=Potri.016G078100 ID=Potri.016G078100.1.v4.1 annot-version=v4.1 ATGAGCAGATCGGGGCAGCCACCAGATCTCAAGAAGTACATGGATAAGAAGCTTCAAATCAAGCTGAATGCAAATAGGATGGTGGTCGGAACACTCCGTG GGTTTGACCAGTTCATGAATTTGGTGGTTGACAACACTGTGGACGTGAATGGTGATGAGAAAACTGACATAGGCATGGTGGTGATCAGAGGCAATAGTGT TGTCACTGTTGAAGCGTTGGAACCTGTGACCAGAACGCAGTGA
AA sequence Show only first row Show all	>Potri.016G078100.1 pacid=42810617 polypeptide=Potri.016G078100.1.p locus=Potri.016G078100 ID=Potri.016G078100.1.v4.1 annot-version=v4.1 MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVDVNGDEKTDIGMVVIRGNSVVTVEALEPVTRTQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G11500			Small nuclear ribonucleoprotei...		Potri.016G078100 [exp]	0	1
AT1G09690			Translation protein SH3-like f...		Potri.001G071100 [exp]	5.19	0.8855	RPL21.2
AT1G49410		TOM6	translocase of the outer mitoc...		Potri.009G110100 [exp]	6.00	0.8353
AT1G26880			Ribosomal protein L34e superfa...		Potri.015G106532 [exp]	9.48	0.8806
AT5G59970			Histone superfamily protein (....		Potri.018G092900 [exp]	12.04	0.7321	HFO901
AT4G31720		STG1, TAFII15, ...	TBP-ASSOCIATED FACTOR 10, SALT...		Potri.018G013300 [exp]	12.96	0.7892
AT3G16080			Zinc-binding ribosomal protein...		Potri.001G183200 [exp]	13.19	0.8495	Pt-RPL37.3
AT5G62390		ATBAG7	BCL-2-associated athanogene 7 ...		Potri.012G126000 [exp]	27.65	0.7863	CBP.2
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Potri.013G027600 [exp]	28.00	0.8378	ATBBC1.1
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.015G007100 [exp]	28.37	0.8529	UBQ1.4
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Potri.004G131900 [exp]	28.91	0.8211

Compare expression of checked genes

Potri.016G078100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.