Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01060 173 / 5e-53 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT5G06800 155 / 4e-45 GARP myb-like HTH transcriptional regulator family protein (.1.2) AT5G29000 140 / 2e-39 GARP PHL1 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) AT4G28610 139 / 1e-38 GARP ATPHR1, PHR1 phosphate starvation response 1 (.1) AT3G04450 138 / 2e-38 GARP Homeodomain-like superfamily protein (.1.2) AT3G24120 135 / 3e-38 GARP Homeodomain-like superfamily protein (.1.2) AT3G04030 137 / 6e-38 GARP Homeodomain-like superfamily protein (.1.2.3) AT5G18240 134 / 4e-37 GARP MYR1, ATMYR1 ARABIDOPSIS MYB-RELATED PROTEIN 1, myb-related protein 1 (.1.2.3.4.5) AT4G13640 132 / 6e-37 GARP UNE16 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2) AT1G69580 132 / 1e-36 GARP Homeodomain-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G101000 [exp] 451 / 4e-163 AT2G01060 179 / 2e-55 myb-like HTH transcriptional regulator family protein (.1.2) Potri.006G000800 [exp] 174 / 7e-53 AT2G01060 321 / 1e-109 myb-like HTH transcriptional regulator family protein (.1.2) Potri.016G001100 [exp] 172 / 3e-52 AT2G01060 318 / 5e-109 myb-like HTH transcriptional regulator family protein (.1.2) Potri.006G191000 [exp] 146 / 2e-41 AT5G06800 252 / 2e-80 myb-like HTH transcriptional regulator family protein (.1.2) Potri.014G000700 [exp] 146 / 3e-41 AT3G13040 308 / 6e-101 myb-like HTH transcriptional regulator family protein (.1.2) Potri.019G020900 [exp] 142 / 1e-39 AT5G29000 306 / 4e-101 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) Potri.016G047900 [exp] 139 / 4e-39 AT5G06800 233 / 3e-73 myb-like HTH transcriptional regulator family protein (.1.2) Potri.007G003200 [exp] 139 / 4e-38 AT3G13040 330 / 1e-108 myb-like HTH transcriptional regulator family protein (.1.2) Potri.001G314800 [exp] 135 / 5e-38 AT4G13640 345 / 2e-119 unfertilized embryo sac 16, Homeodomain-like superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002483 [exp] 334 / 1e-116 AT2G01060 168 / 6e-51 myb-like HTH transcriptional regulator family protein (.1.2) Lus10004809 [exp] 331 / 2e-115 AT2G01060 171 / 5e-52 myb-like HTH transcriptional regulator family protein (.1.2) Lus10027806 [exp] 274 / 4e-93 AT2G01060 172 / 6e-53 myb-like HTH transcriptional regulator family protein (.1.2) Lus10005036 [exp] 270 / 2e-91 AT2G01060 175 / 4e-54 myb-like HTH transcriptional regulator family protein (.1.2) Lus10039124 [exp] 167 / 2e-50 AT2G01060 350 / 6e-122 myb-like HTH transcriptional regulator family protein (.1.2) Lus10038734 [exp] 158 / 3e-47 AT2G01060 324 / 1e-111 myb-like HTH transcriptional regulator family protein (.1.2) Lus10024938 [exp] 147 / 2e-41 AT4G28610 314 / 2e-103 phosphate starvation response 1 (.1) Lus10008197 [exp] 142 / 9e-40 AT5G29000 318 / 3e-105 PHR1-like 1, Homeodomain-like superfamily protein (.1.2.3.4) Lus10022886 [exp] 143 / 1e-39 AT4G28610 310 / 7e-102 phosphate starvation response 1 (.1) Lus10035705 [exp] 142 / 4e-39 AT3G13040 372 / 4e-125 myb-like HTH transcriptional regulator family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain CL0123 [poplar] [flax] PF14379 [poplar] [flax] Myb_CC_LHEQLE MYB-CC type transfactor, LHEQLE motif
Representative CDS sequence Show only first row Show all	>Potri.016G117000.1 pacid=42809068 polypeptide=Potri.016G117000.1.p locus=Potri.016G117000 ID=Potri.016G117000.1.v4.1 annot-version=v4.1 ATGGGTCGAAGTCGCTCCGACAGATCTAACAAAGACAGATTGCGTTGGACACAAGAACTACATGATCGGTTCGAAGAGGCTGTTAATCAACTTGGTGGTC CTGATAGAGCAACACCGAAAGGTATCTTGAGGGCTATGGGCATCCCTGGATTGACTATCTACCATGTCAAGAGCCATTTGCAGAAATACAGAATCTCGAA GTTTATCCCAGAAACCAACAGAGGCAAGTTTGAAAGGAGAAATATTTCAGAAATGTTACCGAATTTCAGTGCAACATCAGGTGCTCAACTAAATGAAGCG TTACTGATGCAAATGGAGGTCCATAGGCGACTGAGTGATCAACTTGTGGTTCAAAAGAGCTTGAAGCTTAAAATTGAAGCCCAAGGGAGATTCCTTGAGA GAATTGTGGAGGAAAATCAAAATGGAAATCCAAAACACACCAAGTCTTTCTCTCCGGTATCAATGCCATCTCTCTGCGATTCAGAATCAAATGCTAAGGA ATTTGAAACTGATACGGAGGGTGAGAAAGTTGAAATACAGTCTGAAGAAGACTTTCAAGCTCTTAAGAGATTAAGGACCGAACACCATGTTTTGCCTTCA CGGTATCAACTGGAACCTCTCAATCCAGATCCTTACAATCAAAACATGGTTCTTCAAAGAGATGCAAAATTTTCACATCCATCTCATGACGTCAACTTCC CATGGGACATTTTGGCCACCTGTTCATCACCTCTAGAGCCTAGTTTTTTCTAG
AA sequence Show only first row Show all	>Potri.016G117000.1 pacid=42809068 polypeptide=Potri.016G117000.1.p locus=Potri.016G117000 ID=Potri.016G117000.1.v4.1 annot-version=v4.1 MGRSRSDRSNKDRLRWTQELHDRFEEAVNQLGGPDRATPKGILRAMGIPGLTIYHVKSHLQKYRISKFIPETNRGKFERRNISEMLPNFSATSGAQLNEA LLMQMEVHRRLSDQLVVQKSLKLKIEAQGRFLERIVEENQNGNPKHTKSFSPVSMPSLCDSESNAKEFETDTEGEKVEIQSEEDFQALKRLRTEHHVLPS RYQLEPLNPDPYNQNMVLQRDAKFSHPSHDVNFPWDILATCSSPLEPSFF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G01060	GARP		myb-like HTH transcriptional r...		Potri.016G117000 [exp]	0	1
					Potri.019G012483 [exp]	28.70	0.8226
AT1G66680		AR401	S-adenosyl-L-methionine-depend...		Potri.012G068600 [exp]	36.00	0.8287
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014374 [exp]	37.24	0.8066
AT4G02550			unknown protein		Potri.015G008050 [exp]	38.20	0.8219
AT1G11800			endonuclease/exonuclease/phosp...		Potri.004G010900 [exp]	43.78	0.7874
AT4G02550			unknown protein		Potri.012G061366 [exp]	47.47	0.8170
AT3G51840		ATG6, ATSCX, AC...	acyl-CoA oxidase 4 (.1)		Potri.006G101800 [exp]	47.74	0.7448	Pt-ACX4.1
AT5G04000			unknown protein		Potri.016G044001 [exp]	48.25	0.8119
AT5G36930			Disease resistance protein (TI...		Potri.006G283600 [exp]	49.35	0.8195
AT3G14470			NB-ARC domain-containing disea...		Potri.003G025904 [exp]	57.13	0.7933

Compare expression of checked genes

Potri.016G117000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.