Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32490 156 / 6e-48 AtENODL4 early nodulin-like protein 4 (.1) AT4G28365 154 / 4e-47 AtENODL3 early nodulin-like protein 3 (.1) AT5G53870 150 / 1e-43 AtENODL1 early nodulin-like protein 1 (.1) AT4G27520 142 / 7e-41 AtENODL2 early nodulin-like protein 2 (.1) AT3G20570 115 / 5e-32 AtENODL9 early nodulin-like protein 9 (.1) AT2G25060 111 / 1e-30 AtENODL14 early nodulin-like protein 14 (.1) AT4G30590 105 / 2e-28 AtENODL12 early nodulin-like protein 12 (.1) AT5G25090 102 / 3e-27 AtENODL13 early nodulin-like protein 13 (.1) AT4G31840 99 / 1e-25 AtENODL15 early nodulin-like protein 15 (.1) AT1G48940 97 / 3e-25 AtENODL6 early nodulin-like protein 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G117800 [exp] 173 / 7e-53 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1) Potri.001G398800 [exp] 170 / 2e-51 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1) Potri.001G419200 [exp] 103 / 2e-27 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1) Potri.011G135400 [exp] 102 / 7e-27 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1) Potri.015G052000 [exp] 99 / 5e-26 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1) Potri.006G264600 [exp] 98 / 1e-25 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1) Potri.018G018200 [exp] 97 / 4e-25 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1) Potri.006G184100 [exp] 96 / 1e-24 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1) Potri.001G187700 [exp] 89 / 4e-22 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018617 [exp] 158 / 1e-48 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1) Lus10039852 [exp] 152 / 1e-46 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1) Lus10009196 [exp] 135 / 1e-38 AT5G53870 154 / 3e-44 early nodulin-like protein 1 (.1) Lus10043063 [exp] 105 / 6e-28 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1) Lus10011158 [exp] 103 / 2e-27 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1) Lus10003432 [exp] 94 / 6e-24 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1) Lus10026880 [exp] 94 / 1e-23 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1) Lus10009617 [exp] 92 / 3e-23 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1) Lus10019955 [exp] 87 / 2e-21 AT4G30590 120 / 1e-34 early nodulin-like protein 12 (.1) Lus10032111 [exp] 87 / 3e-21 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.017G011200.1 pacid=42814165 polypeptide=Potri.017G011200.1.p locus=Potri.017G011200 ID=Potri.017G011200.1.v4.1 annot-version=v4.1 ATGGGGTCTAAGAGATTTTCTGGTTCTTTGTTTGTGATGCTGGTCTTGGGGTTTCTTCTTGGGGTTTCTCGGGGTTATAAATTCTATGTTGGTGGTAAAG ATGGTTGGGCTACAAACCCTTCTGAGAGATACAGTCACTGGGCTGAAAGAAACAGGTTTCAAGTCAATGATACTCTCTTTTTCAAGTACAAGAAAGGATC GGATTCAGTCTTGATAGTAAGCAAAGATGATTACAACTCATGCAACACCAAGAACCCTATAAAATCCTTAACAGATGGTGACTCAACTTTCATCTTTGAT CGTTCTGGTCCTTTCTTTTTTATTAGTGGCAATGCTGATGATTGCAATAAGGGTAAGAAACTGATAATCGTTGTCATGGCTGTGAGACCAAAACCCCTCC CTCCTACTCCTTATTCTCCCATAACACCAGCTTCTTCACCTCAACCTACTAGTTCTCCACCGGCTGTGTCTCCGGATGCTCGGAGTCCTTCGGATTCCGC TGGTCCTGCGCAGGCTCCATCGACTAATAGTAAATCGGGTTCGTCGGGTCTTACTGCTGGTTCATTGTCAGTTGGGTTGGTTTTGGGTGCTAGCATAGGG GTTAGCTTCATATTGGGTGGCTTTCTTAGGGTTGTTTAA
AA sequence Show only first row Show all	>Potri.017G011200.1 pacid=42814165 polypeptide=Potri.017G011200.1.p locus=Potri.017G011200 ID=Potri.017G011200.1.v4.1 annot-version=v4.1 MGSKRFSGSLFVMLVLGFLLGVSRGYKFYVGGKDGWATNPSERYSHWAERNRFQVNDTLFFKYKKGSDSVLIVSKDDYNSCNTKNPIKSLTDGDSTFIFD RSGPFFFISGNADDCNKGKKLIIVVMAVRPKPLPPTPYSPITPASSPQPTSSPPAVSPDARSPSDSAGPAQAPSTNSKSGSSGLTAGSLSVGLVLGASIG VSFILGGFLRVV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G32490		AtENODL4	early nodulin-like protein 4 (...		Potri.017G011200 [exp]	0	1
AT1G75710	C2H2ZnF		C2H2-like zinc finger protein ...		Potri.005G173400 [exp]	6.32	0.8405
AT2G35160		SGD9, SUVH5	SET DOMAIN-CONTAINING PROTEIN ...		Potri.012G115500 [exp]	9.16	0.8294
AT5G56350			Pyruvate kinase family protein...		Potri.019G032600 [exp]	11.48	0.8330
AT3G51290			Protein of unknown function (D...		Potri.007G056700 [exp]	12.32	0.8627
AT1G03670			ankyrin repeat family protein ...		Potri.019G101700 [exp]	17.66	0.8512
AT3G09032			unknown protein		Potri.006G097700 [exp]	20.34	0.7868
AT2G44930			Plant protein of unknown funct...		Potri.017G019300 [exp]	21.70	0.8641
AT4G39130			Dehydrin family protein (.1)		Potri.009G120100 [exp]	26.85	0.7568
AT5G45540			Protein of unknown function (D...		Potri.012G018400 [exp]	28.49	0.8510
AT2G28150			Domain of unknown function (DU...		Potri.009G005800 [exp]	29.93	0.7790

Compare expression of checked genes

Potri.017G011200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.