Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	MYB174
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46410 70 / 2e-17 MYB CPC CAPRICE, Homeodomain-like superfamily protein (.1) AT1G01380 68 / 5e-17 MYB ETC1 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) AT5G53200 65 / 2e-15 MYB TRY TRIPTYCHON, Homeodomain-like superfamily protein (.1) AT4G01060 64 / 2e-15 MYB CPL3, ETC3 ENHANCER OF TRY AND CPC 3, CAPRICE-like MYB3 (.1.2.3) AT2G30420 62 / 3e-14 MYB ETC2 ENHANCER OF TRY AND CPC 2, Homeodomain-like superfamily protein (.1) AT2G30424 59 / 3e-13 MYB TCL2 TRICHOMELESS 2, Homeodomain-like superfamily protein (.1) AT2G30432 58 / 6e-13 MYB TCL1 TRICHOMELESS1, Homeodomain-like superfamily protein (.1) AT5G14750 57 / 1e-11 MYB WER1, WER, AtMYB66 WEREWOLF 1, WEREWOLF, myb domain protein 66 (.1) AT3G13540 57 / 2e-11 MYB ATMYB5, ATM2 myb domain protein 5 (.1) AT5G35550 57 / 2e-11 MYB ATTT2, TT2, AtMYB123 TRANSPARENT TESTA 2, MYB DOMAIN PROTEIN 123, Duplicated homeodomain-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G122800 [exp] 112 / 1e-34 AT2G46410 69 / 3e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.011G026300 [exp] 105 / 8e-32 AT1G01380 68 / 9e-17 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) Potri.004G021300 [exp] 104 / 2e-31 AT1G01380 67 / 1e-16 ENHANCER OF TRY AND CPC 1, Homeodomain-like superfamily protein (.1) Potri.004G015100 [exp] 89 / 3e-25 AT2G46410 71 / 1e-17 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.002G168900 [exp] 71 / 2e-17 AT5G53200 122 / 2e-37 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.014G096300 [exp] 70 / 3e-17 AT2G46410 114 / 1e-34 CAPRICE, Homeodomain-like superfamily protein (.1) Potri.012G031200 [exp] 68 / 4e-16 AT5G53200 102 / 6e-29 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.015G022000 [exp] 66 / 7e-16 AT5G53200 104 / 2e-30 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Potri.018G005300 [exp] 65 / 7e-14 AT1G22640 186 / 9e-57 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018366 [exp] 82 / 4e-22 AT2G46410 67 / 2e-15 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10007643 [exp] 79 / 5e-21 AT2G46410 65 / 3e-15 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10018414 [exp] 84 / 8e-21 AT4G05120 548 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10005949 [exp] 66 / 1e-15 AT4G01060 91 / 2e-25 ENHANCER OF TRY AND CPC 3, CAPRICE-like MYB3 (.1.2.3) Lus10038822 [exp] 65 / 2e-15 AT5G53200 96 / 1e-27 TRIPTYCHON, Homeodomain-like superfamily protein (.1) Lus10014933 [exp] 64 / 4e-15 AT2G46410 96 / 1e-27 CAPRICE, Homeodomain-like superfamily protein (.1) Lus10001043 [exp] 64 / 1e-14 AT1G22640 119 / 1e-33 ARABIDOPSIS THALIANA MYB DOMAIN PROTEIN 3, myb domain protein 3 (.1) Lus10009130 [exp] 61 / 1e-12 AT1G66370 202 / 3e-64 myb domain protein 113 (.1) Lus10028513 [exp] 61 / 1e-12 AT1G66370 205 / 3e-65 myb domain protein 113 (.1) Lus10039173 [exp] 61 / 1e-12 AT3G13540 244 / 3e-81 myb domain protein 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF00249 [poplar] [flax] Myb_DNA-binding Myb-like DNA-binding domain
Representative CDS sequence Show only first row Show all	>Potri.017G037000.1 pacid=42813872 polypeptide=Potri.017G037000.1.p locus=Potri.017G037000 ID=Potri.017G037000.1.v4.1 annot-version=v4.1 ATGGCTGACTTGGATCACTCCTCTAGTGATGACAACTCTGTTGATTCTAGAGAGGAAACCAGCCAAGATTCGAAGCTTGAATTCTCAGAAGATGAGGAAA CTCTTATCACCAGGATGTACAATCTGGTTGGTGAGAGGTGGCCCTTAATTGCTGGGAGGATTCCAGGAAGAACAGCAGAAGAAATTGAGAAGTACTGGAC TTCAAGATACTCTACAAGTCAGTAA
AA sequence Show only first row Show all	>Potri.017G037000.1 pacid=42813872 polypeptide=Potri.017G037000.1.p locus=Potri.017G037000 ID=Potri.017G037000.1.v4.1 annot-version=v4.1 MADLDHSSSDDNSVDSREETSQDSKLEFSEDEETLITRMYNLVGERWPLIAGRIPGRTAEEIEKYWTSRYSTSQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46410	MYB	CPC	CAPRICE, Homeodomain-like supe...		Potri.017G037000 [exp]	0	1	MYB174
AT1G55265			Protein of unknown function, D...		Potri.003G217300 [exp]	3.00	0.7258
AT1G69330			RING/U-box superfamily protein...		Potri.010G161100 [exp]	3.46	0.7645
AT1G65032			unknown protein		Potri.005G094100 [exp]	4.00	0.7963
AT5G10980			Histone superfamily protein (....		Potri.007G014300 [exp]	4.89	0.7715
AT1G69390		ARC12, ATMINE1	accumulation and replication o...		Potri.010G162600 [exp]	6.92	0.7690
AT1G31340		NEDD8, ATRUB1, ...	ARABIDOPSIS THALIANA RELATED T...		Potri.005G096700 [exp]	10.24	0.7570	Pt-UBQ7.2
AT1G09660			RNA-binding KH domain-containi...		Potri.004G225900 [exp]	12.40	0.6741
AT3G60480			unknown protein		Potri.014G054300 [exp]	12.72	0.7531
AT3G16640		TCTP	translationally controlled tum...		Potri.008G221200 [exp]	13.41	0.7249
AT3G07500	FAR1_related		Far-red impaired responsive (F...		Potri.014G176500 [exp]	14.00	0.6665

Compare expression of checked genes

Potri.017G037000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.