Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27035 121 / 2e-35 AtENODL20 early nodulin-like protein 20 (.1) AT5G15350 118 / 6e-34 AtENODL17 early nodulin-like protein 17 (.1) AT4G12880 100 / 1e-27 AtENODL19 early nodulin-like protein 19 (.1.2) AT3G01070 84 / 1e-20 AtENODL16 early nodulin-like protein 16 (.1) AT5G26330 64 / 5e-13 Cupredoxin superfamily protein (.1) AT3G60280 62 / 8e-12 UCC3 uclacyanin 3 (.1) AT3G27200 61 / 8e-12 Cupredoxin superfamily protein (.1) AT5G07475 61 / 9e-12 Cupredoxin superfamily protein (.1) AT3G17675 57 / 5e-11 Cupredoxin superfamily protein (.1) AT2G23990 59 / 6e-11 AtENODL11 early nodulin-like protein 11 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G219900 [exp] 144 / 4e-44 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1) Potri.001G219800 [exp] 140 / 2e-42 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1) Potri.017G088600 [exp] 120 / 5e-35 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1) Potri.003G183300 [exp] 109 / 2e-30 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1) Potri.001G043600 [exp] 103 / 2e-28 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1) Potri.004G121100 [exp] 102 / 8e-28 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1) Potri.013G030000 [exp] 73 / 2e-16 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.013G030450 [exp] 73 / 2e-16 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.008G151000 [exp] 66 / 1e-13 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005229 [exp] 155 / 8e-49 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1) Lus10026749 [exp] 130 / 1e-38 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1) Lus10025536 [exp] 105 / 5e-29 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1) Lus10030690 [exp] 102 / 2e-27 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1) Lus10025535 [exp] 106 / 4e-27 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1) Lus10026064 [exp] 100 / 6e-27 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1) Lus10005231 [exp] 100 / 8e-27 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1) Lus10014356 [exp] 94 / 1e-24 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1) Lus10012165 [exp] 66 / 1e-13 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1) Lus10007582 [exp] 67 / 4e-13 AT4G35110 120 / 2e-29 Arabidopsis phospholipase-like protein (PEARLI 4) family (.1), Arabidopsis phospholipase-like protein (PEARLI 4) family (.2), Arabidopsis phospholipase-like protein (PEARLI 4) family (.3), Arabidopsis phospholipase-like protein (PEARLI 4) family (.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.017G088500.1 pacid=42813325 polypeptide=Potri.017G088500.1.p locus=Potri.017G088500 ID=Potri.017G088500.1.v4.1 annot-version=v4.1 ATGGAGAATTCAGGGAGGACGACAATTGGAAAAACTGTATTGTCCATGGCAATAACAGCAGTGACTGTTATGATGATTGTGGAATGTGCAGCTGCTGAGC AGCTATATAAGGTGGGCTCAAGAGGATGGATCCCAAATTATAATTACACTGACTGGTTGAATCAGAGTCATGAGCATTTCTACGTTGGTGATTGGCTTCT TTTTGTGTTTGACAAGCACTCCTACAATGTCCTGGAGGTCAACGAAACAAGCTATGAGAACTGCAATGACCAAGGCTTCATAAAGAACATTACTCGTGGC GGCCGGGATGTGGTTCAACTGACAGAGGCAAGGCGTTATTACTTCCTGAGCAGTGGAGGGTATTGCTGGAATGGAATGAAAGTTGCTATCAATGTTGAAG ATTTTGCACCTACCCCAGCACCTGCATCAAGTACTGAAAATGGTTCTCCATCAAATATAGTCAGCAGGCAGATGATTATATTGATTGCATTTTGTGTTGC TTTGGAATGGATGGTCCTTTTTCTTTAA
AA sequence Show only first row Show all	>Potri.017G088500.1 pacid=42813325 polypeptide=Potri.017G088500.1.p locus=Potri.017G088500 ID=Potri.017G088500.1.v4.1 annot-version=v4.1 MENSGRTTIGKTVLSMAITAVTVMMIVECAAAEQLYKVGSRGWIPNYNYTDWLNQSHEHFYVGDWLLFVFDKHSYNVLEVNETSYENCNDQGFIKNITRG GRDVVQLTEARRYYFLSSGGYCWNGMKVAINVEDFAPTPAPASSTENGSPSNIVSRQMIILIAFCVALEWMVLFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27035		AtENODL20	early nodulin-like protein 20 ...		Potri.017G088500 [exp]	0	1
AT3G56770	bHLH	bHLH107	basic helix-loop-helix (bHLH) ...		Potri.013G117600 [exp]	1.00	0.9085
AT5G24318			O-Glycosyl hydrolases family 1...		Potri.012G017800 [exp]	15.23	0.9068
AT1G47271			Cystathionine beta-synthase (C...		Potri.005G228300 [exp]	19.20	0.8919
AT2G23950			Leucine-rich repeat protein ki...		Potri.006G179400 [exp]	19.62	0.8842
AT2G46630			unknown protein		Potri.002G175400 [exp]	21.90	0.8840
AT5G63500			Protein of unknown function (D...		Potri.012G100100 [exp]	22.58	0.8008
AT3G48770			DNA binding;ATP binding (.1)		Potri.015G103000 [exp]	22.80	0.8501
AT2G20560			DNAJ heat shock family protein...		Potri.007G136600 [exp]	22.84	0.8861
AT4G22010		SKS4	SKU5 similar 4 (.1)		Potri.014G154500 [exp]	23.49	0.8738
AT1G09750			Eukaryotic aspartyl protease f...		Potri.002G104600 [exp]	24.18	0.8549

Compare expression of checked genes

Potri.017G088500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.