Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15350 194 / 5e-64 AtENODL17 early nodulin-like protein 17 (.1) AT4G12880 145 / 6e-45 AtENODL19 early nodulin-like protein 19 (.1.2) AT3G01070 136 / 3e-41 AtENODL16 early nodulin-like protein 16 (.1) AT2G27035 103 / 4e-28 AtENODL20 early nodulin-like protein 20 (.1) AT2G32300 75 / 1e-16 UCC1 uclacyanin 1 (.1) AT2G25060 72 / 6e-16 AtENODL14 early nodulin-like protein 14 (.1) AT3G20570 72 / 1e-15 AtENODL9 early nodulin-like protein 9 (.1) AT5G26330 69 / 8e-15 Cupredoxin superfamily protein (.1) AT2G31050 67 / 7e-14 Cupredoxin superfamily protein (.1) AT3G60280 66 / 2e-13 UCC3 uclacyanin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G121100 [exp] 251 / 3e-86 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1) Potri.017G088500 [exp] 123 / 6e-36 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1) Potri.001G219900 [exp] 117 / 2e-33 AT2G27035 136 / 2e-41 early nodulin-like protein 20 (.1) Potri.003G183300 [exp] 114 / 3e-32 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1) Potri.001G219800 [exp] 114 / 6e-32 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1) Potri.001G043600 [exp] 112 / 8e-32 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1) Potri.003G047300 [exp] 79 / 4e-18 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.001G080700 [exp] 75 / 4e-17 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1) Potri.002G161300 [exp] 73 / 2e-16 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030690 [exp] 238 / 7e-81 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1) Lus10005231 [exp] 237 / 2e-80 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1) Lus10026749 [exp] 107 / 1e-29 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1) Lus10005229 [exp] 104 / 1e-28 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1) Lus10026064 [exp] 104 / 2e-28 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1) Lus10014356 [exp] 100 / 1e-26 AT5G15350 108 / 2e-30 early nodulin-like protein 17 (.1) Lus10025535 [exp] 87 / 3e-20 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1) Lus10007026 [exp] 83 / 3e-20 AT2G32300 96 / 4e-25 uclacyanin 1 (.1) Lus10025536 [exp] 81 / 2e-19 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1) Lus10012085 [exp] 74 / 1e-16 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [poplar] [flax] CU_oxidase PF02298 [poplar] [flax] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Potri.017G088600.1 pacid=42814611 polypeptide=Potri.017G088600.1.p locus=Potri.017G088600 ID=Potri.017G088600.1.v4.1 annot-version=v4.1 ATGGAGAGAGGAAGTGGGTTTGGTTCACCCATGATGGTGGCATTGGCAGTGCTTGTTTTTGCCATGGTGGTGATGGTACCTGAAGTGTCTGCAACTAGAT GGACAGTTGGATCTAACATGGGTTGGACTAGTAATGTCAACTACACTATTTGGGCTCAAGGAAAGCATTTCTACAATGGTGACTGGCTCTTTTTCGTGTA TGATAGGAACCAAATGAATATTTTAGAGGTGAACAAGACAGACTATGAGTCGTGCAACTCTGATCATCCTCTTCACAATTGGACCAGGGGAGCTGGAAGA GACGTGGTTCCACTGAACGTCACTCGCAATTACTATTTCATTAGTGGCAAGGGGTTCTGCTATGGAGGCATGAAGCTAGCTGTCCATGTAGAAAACCCAC CTCCCCCACCTACTGCTTCCCCACTAGATGAGAAGAGTGGCTCTCCAAGTTCCATTTTCAGAAGCCAGTATGTTCTGCCGACTGTTTTTGCCATTGGTGC TCTATGGGATGCATTCGTCCGGTTCTGGTAG
AA sequence Show only first row Show all	>Potri.017G088600.1 pacid=42814611 polypeptide=Potri.017G088600.1.p locus=Potri.017G088600 ID=Potri.017G088600.1.v4.1 annot-version=v4.1 MERGSGFGSPMMVALAVLVFAMVVMVPEVSATRWTVGSNMGWTSNVNYTIWAQGKHFYNGDWLFFVYDRNQMNILEVNKTDYESCNSDHPLHNWTRGAGR DVVPLNVTRNYYFISGKGFCYGGMKLAVHVENPPPPPTASPLDEKSGSPSSIFRSQYVLPTVFAIGALWDAFVRFW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Potri.017G088600 [exp]	0	1
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Potri.002G093100 [exp]	1.41	0.9543	Pt-SAH7.1
AT5G04160			Nucleotide-sugar transporter f...		Potri.006G046600 [exp]	3.46	0.9416
AT2G46170			Reticulon family protein (.1.2...		Potri.002G165400 [exp]	3.74	0.9193
AT2G34770		ATFAH1, FAH1	ARABIDOPSIS FATTY ACID HYDROXY...		Potri.011G162000 [exp]	4.89	0.9412	Pt-FAH1.1
AT4G12420		SKU5	Cupredoxin superfamily protein...		Potri.003G112700 [exp]	5.09	0.9442	Pt-SKU5.1
AT3G58100		PDCB5	plasmodesmata callose-binding ...		Potri.013G119500 [exp]	5.19	0.9181
AT4G12420		SKU5	Cupredoxin superfamily protein...		Potri.001G120300 [exp]	6.70	0.9278	SKU5.2
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Potri.006G121700 [exp]	6.92	0.9159	Pt-TIP2.7
AT5G15230		GASA4	GAST1 protein homolog 4 (.1.2)		Potri.017G083000 [exp]	7.21	0.9154	GASA4.2
AT4G03100			Rho GTPase activating protein ...		Potri.014G135570 [exp]	8.36	0.9174

Compare expression of checked genes

Potri.017G088600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.