Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14460 143 / 7e-39 LRR and NB-ARC domains-containing disease resistance protein (.1) AT3G14470 143 / 1e-38 NB-ARC domain-containing disease resistance protein (.1) AT3G50950 117 / 6e-30 ZAR1 HOPZ-ACTIVATED RESISTANCE 1 (.1.2) AT3G07040 110 / 3e-27 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRINGAE 3, RESISTANCE TO P. SYRINGAE PV MACULICOLA 1, NB-ARC domain-containing disease resistance protein (.1) AT1G12220 96 / 2e-22 RPS5 RESISTANT TO P. SYRINGAE 5, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT3G46730 96 / 2e-22 NB-ARC domain-containing disease resistance protein (.1) AT1G58390 93 / 2e-21 Disease resistance protein (CC-NBS-LRR class) family (.1) AT5G63020 92 / 3e-21 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G61180 91 / 9e-21 LRR and NB-ARC domains-containing disease resistance protein (.1.2) AT1G50180 90 / 2e-20 NB-ARC domain-containing disease resistance protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G136266 [exp] 429 / 3e-144 AT3G14470 412 / 2e-126 NB-ARC domain-containing disease resistance protein (.1) Potri.017G136400 [exp] 421 / 4e-142 AT3G14470 413 / 5e-128 NB-ARC domain-containing disease resistance protein (.1) Potri.017G136700 [exp] 410 / 2e-139 AT3G14470 376 / 9e-116 NB-ARC domain-containing disease resistance protein (.1) Potri.017G138100 [exp] 402 / 1e-133 AT3G14470 397 / 4e-121 NB-ARC domain-containing disease resistance protein (.1) Potri.017G133666 [exp] 399 / 1e-133 AT3G14470 416 / 7e-129 NB-ARC domain-containing disease resistance protein (.1) Potri.017G133600 [exp] 396 / 3e-132 AT3G14470 424 / 4e-132 NB-ARC domain-containing disease resistance protein (.1) Potri.017G137700 [exp] 390 / 4e-129 AT3G14470 437 / 7e-136 NB-ARC domain-containing disease resistance protein (.1) Potri.017G127200 [exp] 300 / 1e-94 AT3G14470 404 / 4e-123 NB-ARC domain-containing disease resistance protein (.1) Potri.017G121700 [exp] 297 / 9e-94 AT3G14470 461 / 2e-144 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005218 [exp] 167 / 4e-47 AT3G14470 379 / 2e-113 NB-ARC domain-containing disease resistance protein (.1) Lus10022351 [exp] 162 / 3e-45 AT3G14470 369 / 1e-108 NB-ARC domain-containing disease resistance protein (.1) Lus10024173 [exp] 154 / 2e-42 AT3G14460 681 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10022792 [exp] 153 / 2e-42 AT3G14470 343 / 7e-102 NB-ARC domain-containing disease resistance protein (.1) Lus10011278 [exp] 152 / 8e-42 AT3G14470 356 / 1e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10007261 [exp] 150 / 3e-41 AT3G14460 654 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10039540 [exp] 147 / 2e-40 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10022900 [exp] 147 / 3e-40 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10005321 [exp] 147 / 6e-40 AT3G14460 607 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10039509 [exp] 144 / 4e-39 AT3G14460 613 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00931 [poplar] [flax] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Potri.017G137801.1 pacid=42813965 polypeptide=Potri.017G137801.1.p locus=Potri.017G137801 ID=Potri.017G137801.1.v4.1 annot-version=v4.1 ATGGTTACTCGTAGAATGGCAGCAACTTTTGTCCAGCCCATGGGGAGATTGTCTGAAGAAGATTCTTGGCATTTGTTTCAACGGCTTGCATTTGGGATGA AAAGGACAGAGGAGCGGGCGCAACTGGAAGCCATTGGAGTATCAATAGTGAAGAAGTGTGGTGGTGTTCCATTAGCTATAAAGGCACTCGGGAACCTAAT GCGGCTAAAAGATAATGAAGATCAGTGGATAGCTGTCAAAGAAAGTGAGATTTGGGATCTAAGAGAAGAAGCAAGCAAGATTTTACCTGCTTTGAGGTTG AGTTACACTAATCTATCACCACATTTGAAGCAATGCTTTGCGTTTTGCGCAATATTTCCAAAAGATCAGGTGATGATGAGGGAGGAGCTGATTGCTTTGT GGATGGCAAATGGCTTTATTTCTTGCAGAAGAGAAATGAATTTGCACGTCACGGGTATTGAGATATTCAATGAACTAGTGGGAAGGTCATTTCTGCAAGA GGTCGAGGATGATGGATTTGGCAACATCACATGTAAAATGCATGATCTTATGCATGATCTCGCACAATCCATTGCAGTACAAGAATGCTATATGAGTACA GAAGGCGATGGGAAGTTGGAAATTCCTAAAACTGTCCGTCATGTAGCTTTTTATAACAAATCAGTAGCTTCGTCTTCTAAAGGTCTCAAGGTCCTATCAC TTCGCTCACTTCTTTTGAGGAATAAATAG
AA sequence Show only first row Show all	>Potri.017G137801.1 pacid=42813965 polypeptide=Potri.017G137801.1.p locus=Potri.017G137801 ID=Potri.017G137801.1.v4.1 annot-version=v4.1 MVTRRMAATFVQPMGRLSEEDSWHLFQRLAFGMKRTEERAQLEAIGVSIVKKCGGVPLAIKALGNLMRLKDNEDQWIAVKESEIWDLREEASKILPALRL SYTNLSPHLKQCFAFCAIFPKDQVMMREELIALWMANGFISCRREMNLHVTGIEIFNELVGRSFLQEVEDDGFGNITCKMHDLMHDLAQSIAVQECYMST EGDGKLEIPKTVRHVAFYNKSVASSSKGLKVLSLRSLLLRNK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14460			LRR and NB-ARC domains-contain...		Potri.017G137801 [exp]	0	1
AT3G14470			NB-ARC domain-containing disea...		Potri.017G137700 [exp]	2.44	0.9176
AT5G36930			Disease resistance protein (TI...		Potri.006G282900 [exp]	3.46	0.8890
AT5G27550			P-loop containing nucleoside t...		Potri.005G030484 [exp]	5.19	0.8478
AT3G14470			NB-ARC domain-containing disea...		Potri.017G138100 [exp]	7.74	0.8388
AT3G42170			BED zinc finger ;hAT family di...		Potri.016G027201 [exp]	8.71	0.8114
AT3G14470			NB-ARC domain-containing disea...		Potri.017G127800 [exp]	11.95	0.8442
AT3G14470			NB-ARC domain-containing disea...		Potri.017G136400 [exp]	15.81	0.8031
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.011G165700 [exp]	19.59	0.8372
AT3G14470			NB-ARC domain-containing disea...		Potri.014G003600 [exp]	19.89	0.8344
AT5G01750			Protein of unknown function (D...		Potri.016G131300 [exp]	30.98	0.8105

Compare expression of checked genes

Potri.017G137801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.