Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14470 66 / 6e-13 NB-ARC domain-containing disease resistance protein (.1) AT3G14460 64 / 2e-12 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G58400 62 / 5e-12 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G53350 62 / 6e-12 Disease resistance protein (CC-NBS-LRR class) family (.1) AT5G48620 62 / 1e-11 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G59620 61 / 2e-11 CW9 Disease resistance protein (CC-NBS-LRR class) family (.1) AT5G43470 60 / 4e-11 HRT, RCY1, RPP8 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT1G58390 60 / 4e-11 Disease resistance protein (CC-NBS-LRR class) family (.1) AT3G50950 60 / 5e-11 ZAR1 HOPZ-ACTIVATED RESISTANCE 1 (.1.2) AT1G58807 59 / 6e-11 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G017900 [exp] 206 / 5e-63 AT3G14470 299 / 3e-87 NB-ARC domain-containing disease resistance protein (.1) Potri.017G143433 [exp] 196 / 4e-59 AT3G14470 321 / 1e-94 NB-ARC domain-containing disease resistance protein (.1) Potri.017G143820 [exp] 195 / 8e-59 AT3G14470 316 / 3e-93 NB-ARC domain-containing disease resistance protein (.1) Potri.017G140132 [exp] 195 / 8e-59 AT3G14470 292 / 1e-84 NB-ARC domain-containing disease resistance protein (.1) Potri.017G143700 [exp] 195 / 9e-59 AT3G14470 286 / 2e-82 NB-ARC domain-containing disease resistance protein (.1) Potri.004G076700 [exp] 157 / 2e-45 AT3G14470 143 / 4e-35 NB-ARC domain-containing disease resistance protein (.1) Potri.017G136700 [exp] 79 / 1e-17 AT3G14470 376 / 9e-116 NB-ARC domain-containing disease resistance protein (.1) Potri.017G133600 [exp] 77 / 4e-17 AT3G14470 424 / 4e-132 NB-ARC domain-containing disease resistance protein (.1) Potri.001G025400 [exp] 77 / 5e-17 AT3G14470 558 / 0.0 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005218 [exp] 77 / 5e-17 AT3G14470 379 / 2e-113 NB-ARC domain-containing disease resistance protein (.1) Lus10022351 [exp] 71 / 6e-15 AT3G14470 369 / 1e-108 NB-ARC domain-containing disease resistance protein (.1) Lus10028279 [exp] 68 / 6e-14 AT3G14470 337 / 5e-99 NB-ARC domain-containing disease resistance protein (.1) Lus10042117 [exp] 67 / 1e-13 AT3G14470 354 / 2e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10002736 [exp] 65 / 9e-13 AT3G14470 317 / 1e-98 NB-ARC domain-containing disease resistance protein (.1) Lus10039509 [exp] 64 / 3e-12 AT3G14460 613 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10016316 [exp] 61 / 2e-11 AT3G14470 494 / 6e-156 NB-ARC domain-containing disease resistance protein (.1) Lus10024173 [exp] 61 / 3e-11 AT3G14460 681 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10006794 [exp] 61 / 3e-11 AT3G14470 264 / 2e-78 NB-ARC domain-containing disease resistance protein (.1) Lus10039540 [exp] 59 / 8e-11 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00931 [poplar] [flax] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Potri.017G144481.1 pacid=42813296 polypeptide=Potri.017G144481.1.p locus=Potri.017G144481 ID=Potri.017G144481.1.v4.1 annot-version=v4.1 ATGGGTCATAAGATAAAGAGCATCATAGAAAGACTATCTGAGATTTCATCTCTTAAGTGTGACTTCAACCTCAGCGAGCAGACTAATGATTATAGTCATG AGGAAACAGAGATGAACCGATCCTTTGAGAGATTTTCCGGTCTTGTTGGAAGAGATGAAGACAAAGAACGCATCATCAACCTGCTAGTAGAACCTTTTAA GGTTGATGATGCTCATCCCCTTGTCTTTTCGATAGTTGGAATGGGAGGATTGGGGAAGACTGCTCTTGCCAAATCTGTGTATGAGAATGAAATTGTAAAA TCTCATTTTGAACTGAAAATGGAGGCATGTGTTTCAGATGGTTTTGGCTTAAAACAAGTGACACAAAAAATTATTAAATCTGCGACCGGGGAAAGATGTG CAGATTTGGATGAGGGTGAACTAATACAAAAACTGAAGAAATTTTGA
AA sequence Show only first row Show all	>Potri.017G144481.1 pacid=42813296 polypeptide=Potri.017G144481.1.p locus=Potri.017G144481 ID=Potri.017G144481.1.v4.1 annot-version=v4.1 MGHKIKSIIERLSEISSLKCDFNLSEQTNDYSHEETEMNRSFERFSGLVGRDEDKERIINLLVEPFKVDDAHPLVFSIVGMGGLGKTALAKSVYENEIVK SHFELKMEACVSDGFGLKQVTQKIIKSATGERCADLDEGELIQKLKKF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14470			NB-ARC domain-containing disea...		Potri.017G144481 [exp]	0	1
AT1G77060			Phosphoenolpyruvate carboxylas...		Potri.002G073600 [exp]	10.39	0.7494
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G116170 [exp]	17.49	0.6735
					Potri.014G003551 [exp]	18.76	0.7108
AT5G42740			Sugar isomerase (SIS) family p...		Potri.002G262101 [exp]	19.59	0.7346
AT3G63470		SCPL40	serine carboxypeptidase-like 4...		Potri.009G056000 [exp]	24.97	0.6991
					Potri.009G013701 [exp]	29.15	0.7101
AT1G62640		KAS III, KASIII	3-ketoacyl-acyl carrier protei...		Potri.003G112101 [exp]	30.82	0.6738
AT1G31650		ATROPGEF14, ROP...	RHO guanyl-nucleotide exchange...		Potri.001G127300 [exp]	32.32	0.6446
					Potri.006G071801 [exp]	33.19	0.6688
AT3G42170			BED zinc finger ;hAT family di...		Potri.011G104000 [exp]	34.42	0.6135

Compare expression of checked genes

Potri.017G144481 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.