Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21960 100 / 6e-27 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G74930 93 / 4e-24 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1) AT1G19210 92 / 4e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G21910 87 / 2e-21 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT5G67190 85 / 3e-21 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT3G50260 84 / 5e-21 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT4G06746 83 / 8e-21 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT1G77640 84 / 3e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G36900 82 / 4e-20 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT2G23340 81 / 2e-19 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G138900 [exp] 192 / 1e-63 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 97 / 1e-25 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.006G218200 [exp] 96 / 3e-25 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138800 [exp] 93 / 3e-24 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138700 [exp] 87 / 7e-22 AT1G19210 174 / 1e-55 Integrase-type DNA-binding superfamily protein (.1) Potri.014G025200 [exp] 83 / 1e-20 AT1G46768 160 / 3e-51 related to AP2 1 (.1) Potri.007G046500 [exp] 82 / 4e-20 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.002G124000 [exp] 81 / 5e-20 AT1G46768 158 / 3e-50 related to AP2 1 (.1) Potri.005G140900 [exp] 81 / 8e-20 AT5G67190 169 / 1e-53 DREB and EAR motif protein 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038082 [exp] 98 / 7e-26 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10033420 [exp] 92 / 1e-23 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10009798 [exp] 86 / 1e-21 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10034885 [exp] 86 / 4e-21 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1) Lus10010043 [exp] 84 / 4e-21 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10018727 [exp] 84 / 9e-21 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10009373 [exp] 82 / 2e-20 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10009468 [exp] 71 / 4e-16 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10003740 [exp] 72 / 6e-16 AT1G21910 130 / 4e-38 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Lus10028032 [exp] 70 / 7e-16 AT1G21910 117 / 1e-33 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [poplar] [flax] MBD-like PF00847 [poplar] [flax] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Potri.018G038100.1 pacid=42800377 polypeptide=Potri.018G038100.1.p locus=Potri.018G038100 ID=Potri.018G038100.1.v4.1 annot-version=v4.1 ATGGTGAGAGAAAGAAGGGAGCGAGGAGATGATAGCGGGCGTTACAAGGGAGTGAGGATGAGAAAGTGGGGAAAATGGGTAGCAGAAATAAGGCAACCTA ACAGCAGGGATAGAATATGGTTAGGTTCATATAATACTGCAGAGGAAGCAGCAAGAGCATATGATGCTGCTGTTTTGTGTTTACGAGGGCCTTCGGCGAC GTTTCATTTTCCAACGAATATACCGGAAATCCCTGCCATGACAGATCAGGTATTGTCTCCCATGCAGATCAGGGAGGTTGCTTCCAGGCATGCAAGAAGG GGGAGTACTGTGGAGCCCGCAGAGAGGATTGTGGGACCTGGGTTGTGTGAAGTGTCGTCTGGGAGGAGTGGAGAGGTGTACTTGGGTGGTGGAGAGAATA TGGAAGAATGCTTGGAGGGGATTTTTAGTGGGGCATACTATCAAACACCTGGTGTGTGGACAGTTTAA
AA sequence Show only first row Show all	>Potri.018G038100.1 pacid=42800377 polypeptide=Potri.018G038100.1.p locus=Potri.018G038100 ID=Potri.018G038100.1.v4.1 annot-version=v4.1 MVRERRERGDDSGRYKGVRMRKWGKWVAEIRQPNSRDRIWLGSYNTAEEAARAYDAAVLCLRGPSATFHFPTNIPEIPAMTDQVLSPMQIREVASRHARR GSTVEPAERIVGPGLCEVSSGRSGEVYLGGGENMEECLEGIFSGAYYQTPGVWTV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G21960	AP2_ERF		Integrase-type DNA-binding sup...		Potri.018G038100 [exp]	0	1
AT1G21450	GRAS	SCL1	SCARECROW-like 1 (.1)		Potri.005G186500 [exp]	1.00	0.8624	Pt-SCL1.1
AT5G05140			Transcription elongation facto...		Potri.006G035500 [exp]	4.24	0.8373
AT1G71450	AP2_ERF		Integrase-type DNA-binding sup...		Potri.019G075500 [exp]	5.74	0.8300
AT5G16120			alpha/beta-Hydrolases superfam...		Potri.017G114800 [exp]	5.91	0.8358
					Potri.017G145625 [exp]	11.91	0.8452
AT5G25930			Protein kinase family protein ...		Potri.006G235500 [exp]	12.12	0.8451
AT1G60190		AtPUB19	plant U-box 19, ARM repeat sup...		Potri.015G074200 [exp]	12.48	0.7625
AT5G25930			Protein kinase family protein ...		Potri.006G235800 [exp]	16.88	0.8397
AT3G30380			alpha/beta-Hydrolases superfam...		Potri.017G102500 [exp]	17.74	0.8319
					Potri.016G089400 [exp]	20.14	0.8008

Compare expression of checked genes

Potri.018G038100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.