Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30220 172 / 7e-58 RUXF small nuclear ribonucleoprotein F (.1.2) AT2G14285 117 / 2e-36 Small nuclear ribonucleoprotein family protein (.1) AT2G43810 70 / 4e-17 Small nuclear ribonucleoprotein family protein (.1.2) AT3G59810 69 / 5e-17 Small nuclear ribonucleoprotein family protein (.1) AT5G27720 39 / 9e-05 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) AT1G03330 35 / 0.0009 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G167000 [exp] 95 / 3e-27 AT2G14285 62 / 1e-14 Small nuclear ribonucleoprotein family protein (.1) Potri.010G178700 [exp] 72 / 3e-18 AT2G43810 150 / 4e-49 Small nuclear ribonucleoprotein family protein (.1.2) Potri.008G078400 [exp] 71 / 9e-18 AT2G43810 166 / 2e-55 Small nuclear ribonucleoprotein family protein (.1.2) Potri.004G219000 [exp] 41 / 6e-06 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1) Potri.003G014900 [exp] 41 / 6e-06 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1) Potri.002G205700 [exp] 39 / 0.0001 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.014G130700 [exp] 37 / 0.0003 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037606 [exp] 176 / 2e-59 AT4G30220 173 / 2e-58 small nuclear ribonucleoprotein F (.1.2) Lus10006867 [exp] 120 / 9e-38 AT4G30220 119 / 4e-37 small nuclear ribonucleoprotein F (.1.2) Lus10026860 [exp] 67 / 2e-14 AT5G36890 189 / 2e-56 beta glucosidase 42 (.1.2) Lus10004221 [exp] 42 / 2e-05 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 41 / 4e-05 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10000666 [exp] 39 / 5e-05 AT1G03330 184 / 2e-62 Small nuclear ribonucleoprotein family protein (.1) Lus10029641 [exp] 36 / 0.0007 AT1G03330 186 / 4e-63 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [poplar] [flax] Sm-like PF01423 [poplar] [flax] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Potri.018G092200.1 pacid=42801514 polypeptide=Potri.018G092200.1.p locus=Potri.018G092200 ID=Potri.018G092200.1.v4.1 annot-version=v4.1 ATGGCCACTGTACCAGTTAACCCTAAGCCTTTTTTGAACAATCTGACTGGAAAGACTGTTATTGTCAAACTTAAATGGGGAATGGAGTACAAAGGTTTTC TTGCTTCTGTTGATTCATACATGAACCTCCAGCTGGGAAATACTGAAGAGTATATTGATGGACAGTTCACTGGAAATCTGGGAGAGATTTTGATCAGATG CAACAATGTTCTCTACCTTCGTGGAGTTCCGGAGGATGAAGACATAGAAGATGCCGAACGAGACTAA
AA sequence Show only first row Show all	>Potri.018G092200.1 pacid=42801514 polypeptide=Potri.018G092200.1.p locus=Potri.018G092200 ID=Potri.018G092200.1.v4.1 annot-version=v4.1 MATVPVNPKPFLNNLTGKTVIVKLKWGMEYKGFLASVDSYMNLQLGNTEEYIDGQFTGNLGEILIRCNNVLYLRGVPEDEDIEDAERD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Potri.018G092200 [exp]	0	1
AT2G07340		PFD1	PREFOLDIN 1 (.1.2)		Potri.006G079700 [exp]	2.23	0.9129
AT2G43780			unknown protein		Potri.019G096500 [exp]	5.91	0.8914
AT5G49510		PFD3, PDF3	prefoldin 3 (.1.2)		Potri.010G147600 [exp]	7.07	0.8894
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.008G013200 [exp]	12.64	0.9017	RPS28.2
AT2G22425			Microsomal signal peptidase 12...		Potri.008G175775 [exp]	12.64	0.8955
AT4G31985			Ribosomal protein L39 family p...		Potri.018G112301 [exp]	13.07	0.8973
AT5G03220			Mediator complex, subunit Med7...		Potri.016G062800 [exp]	14.00	0.8538
AT5G01650			Tautomerase/MIF superfamily pr...		Potri.006G104500 [exp]	17.46	0.8952
AT1G27435			unknown protein		Potri.001G325000 [exp]	20.29	0.8286
AT1G19580		GAMMACA1 ,GAMMA...	gamma carbonic anhydrase 1 (.1...		Potri.005G229000 [exp]	22.97	0.8843	APFI.2

Compare expression of checked genes

Potri.018G092200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.