Potri.018G129200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20230 92 / 8e-23 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
AT2G32300 94 / 1e-22 UCC1 uclacyanin 1 (.1)
AT2G31050 88 / 4e-21 Cupredoxin superfamily protein (.1)
AT2G26720 83 / 3e-19 Cupredoxin superfamily protein (.1)
AT2G25060 83 / 3e-19 AtENODL14 early nodulin-like protein 14 (.1)
AT3G20570 83 / 4e-19 AtENODL9 early nodulin-like protein 9 (.1)
AT5G26330 80 / 3e-18 Cupredoxin superfamily protein (.1)
AT4G31840 80 / 3e-18 AtENODL15 early nodulin-like protein 15 (.1)
AT3G60270 76 / 9e-17 Cupredoxin superfamily protein (.1)
AT3G17675 74 / 9e-17 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G067300 178 / 3e-55 AT5G20230 97 / 2e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.006G067400 107 / 4e-29 AT5G20230 112 / 2e-31 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.001G192100 105 / 1e-27 AT5G20230 100 / 2e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.018G129400 102 / 6e-27 AT5G20230 114 / 6e-32 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Potri.008G151000 92 / 7e-23 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.003G047300 91 / 6e-22 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.010G089900 90 / 6e-22 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.006G259000 89 / 9e-22 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.006G259101 87 / 3e-21 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006657 139 / 4e-39 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10038098 138 / 8e-39 AT1G45063 107 / 1e-27 copper ion binding;electron carriers (.1.2)
Lus10019405 129 / 2e-35 AT1G45063 107 / 3e-27 copper ion binding;electron carriers (.1.2)
Lus10025752 110 / 1e-29 AT5G20230 101 / 1e-26 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Lus10035911 107 / 1e-28 AT5G20230 95 / 3e-24 SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
Lus10021925 96 / 3e-24 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10010533 94 / 1e-23 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10041211 94 / 2e-23 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10008720 92 / 8e-23 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10020944 87 / 9e-21 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Potri.018G129200.1 pacid=42801853 polypeptide=Potri.018G129200.1.p locus=Potri.018G129200 ID=Potri.018G129200.1.v4.1 annot-version=v4.1
ATGGCAAGAGGACTCGACATGGCGTTCCTTGCAGCAATTGCTGTAGCTGCTTTGATACACGGCTCAGCAGCACAATCAACCCATACGGTAGGTGATACCA
CAGGTTGGGCCATTCCTCCTACTGGTTCTGCTTTCTACTCAACGTGGGCTGCAAGCCAAAACTTCAGTGTTGATGACATTCTAGTTTTTAATTTTGCGGC
CAATACTCATGATGTTGCCAAGGTGACAAAGGCAGATTACGATGCCTGCACCACAACTAGTCCCATTTCTTTGTTCGCCACCCCCCAAGTAAGAATCACC
ATTAATGCTTCAGGAGAGCACTATTTCCTTTGCAATTTTACTGGCCATTGCTCTGGTGGTCAAAAGTTGATGATCAATGTTAGTGCTGCATCTTCTTCTC
CTTCTCCTTCTCCAGCTCCTCAAACATCTTCTCCTACTCCTCAACCCTCTACTCCAGCTCCTCAACCTTCTACACCAGCTCCTCAACCTTCCACTCCAAC
TCCTCAGTCTTCTCCTGCTCCTCAACCTTCCACTCCTACCCCAGCTTCTAGCCCTACCCCAGCTTCTAGCCCATCACCACCAACCCCAGCTTCTAGCCCA
TCACCACCACCTACCACACCTCCTAGTTCATCACCACCATCACCCCCAACTACCACACCACCAACTTCTCCTCCTCCACCAAACTCTGCTACATCTCTTG
GTCTCGCTGGCTTTACCACTTTCTTGTCCATTTTTGTAGCGTTGTGCTATTAG
AA sequence
>Potri.018G129200.1 pacid=42801853 polypeptide=Potri.018G129200.1.p locus=Potri.018G129200 ID=Potri.018G129200.1.v4.1 annot-version=v4.1
MARGLDMAFLAAIAVAALIHGSAAQSTHTVGDTTGWAIPPTGSAFYSTWAASQNFSVDDILVFNFAANTHDVAKVTKADYDACTTTSPISLFATPQVRIT
INASGEHYFLCNFTGHCSGGQKLMINVSAASSSPSPSPAPQTSSPTPQPSTPAPQPSTPAPQPSTPTPQSSPAPQPSTPTPASSPTPASSPSPPTPASSP
SPPPTTPPSSSPPSPPTTTPPTSPPPPNSATSLGLAGFTTFLSIFVALCY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G32300 UCC1 uclacyanin 1 (.1) Potri.018G129200 0 1
AT5G35735 Auxin-responsive family protei... Potri.002G222700 1.00 0.9623
AT4G32180 ATPANK2 pantothenate kinase 2 (.1.2.3) Potri.010G041800 2.44 0.9572
AT5G05300 unknown protein Potri.013G083500 4.12 0.9187
AT5G42440 Protein kinase superfamily pro... Potri.002G065400 4.47 0.9337
AT2G26530 AR781 Protein of unknown function (D... Potri.014G034900 5.47 0.9356 AR781.2
AT5G05580 AtFAD8, SH1, FA... fatty acid desaturase 8 (.1.2) Potri.010G187800 6.32 0.9342 Pt-FAD3.3
AT1G76490 HMGR1, HMG1, At... 3-HYDROXY-3-METHYLGLUTARYL COA... Potri.004G208500 6.70 0.9395 HMGR3.4
AT2G47485 unknown protein Potri.004G095150 8.94 0.9361
AT5G13220 ZIM JAS1, TIFY9, JA... TIFY DOMAIN PROTEIN 9, JASMONA... Potri.003G165000 8.94 0.9390
Potri.012G007100 9.48 0.9186

Potri.018G129200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.