Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 182 / 3e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G16990 161 / 2e-45 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT5G17680 159 / 2e-44 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G41540 152 / 6e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G27170 152 / 7e-42 transmembrane receptors;ATP binding (.1.2) AT5G49140 151 / 2e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G46450 149 / 5e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G58120 149 / 7e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G56540 149 / 8e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44630 149 / 1e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T005501 [exp] 406 / 1e-134 AT5G36930 612 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G003285 [exp] 394 / 1e-129 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G003942 [exp] 383 / 7e-126 AT5G36930 591 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143100 [exp] 254 / 8e-85 AT5G36930 234 / 1e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G084333 [exp] 254 / 2e-82 AT5G36930 347 / 2e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002568 [exp] 252 / 4e-81 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 252 / 5e-81 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G037599 [exp] 262 / 9e-81 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 251 / 2e-80 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039850 [exp] 193 / 6e-56 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018616 [exp] 190 / 5e-55 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 188 / 3e-54 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10015453 [exp] 181 / 5e-54 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10014582 [exp] 172 / 2e-52 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10032101 [exp] 174 / 1e-51 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10042752 [exp] 163 / 8e-51 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10005171 [exp] 174 / 1e-49 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10018309 [exp] 167 / 2e-49 AT1G27180 245 / 1e-71 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041060 [exp] 170 / 4e-48 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00931 [poplar] [flax] NB-ARC NB-ARC domain CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.019G001314.1 pacid=42773999 polypeptide=Potri.019G001314.1.p locus=Potri.019G001314 ID=Potri.019G001314.1.v4.1 annot-version=v4.1 ATGGCTTCCACGTGCTCTGAGTCTCCGTTCTTTTCTTCGTCTTCATCCTCTAGACATAGATGGAACTATGATGTTTTTCTAAGTTTTAGAGGAAAAGATA CCCGCAAGAACTTTACAGATCATCTCTATACCGCCTTAATCCAGGCCGGAATTCATACTTTTAGGGATGACAATGAACTTCCTAGAGGAGAAGAAATCTC TCCACAGCTTGTCAAGGCAATTGAAGGATCAAGGATTTCTATAGTGGTCTTCTCCAAACAATACGCTTCCTCTAGATGGTGTCTTGACGAACTGGTAAAG ATTGTTGAGTGCAGGCAAAAGATTGACCAGGTTGTTCTTCCTATATTCTATGATACGGAGCCTTCAGATGTCCGAAAACAGACCGGGAGTTATGCAAAAG CTTTTGATGAACATGAAGAACACTTCAAGGAAGAAATGGAGAAGGTCAACAAGTGGAGAGGAGCTCTTGCAGAAGCGGGAAATCTATCTGGATGGGGTTT AAACAATGAGGCAAATGGATATGAAGCGGAATTCATCAAAAGGATTGTCAGTGATGTAGCTTGTAAACTGGGAAACAAAACCTTGCACGTAGCCAAGCAC CCAGTAGGTATTTATTCCAGGGTTCAGGGAATTATTTCTTTGCTAAAAGGTGCAAAACCTGATGTTGGCATCGTGGGAATACATGGGATAGCTGGAATAG GCAAGACAACAATAGCAAAAGCTGTGTTAACAAACTTTATTTGGATTTGA
AA sequence Show only first row Show all	>Potri.019G001314.1 pacid=42773999 polypeptide=Potri.019G001314.1.p locus=Potri.019G001314 ID=Potri.019G001314.1.v4.1 annot-version=v4.1 MASTCSESPFFSSSSSSRHRWNYDVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLVKAIEGSRISIVVFSKQYASSRWCLDELVK IVECRQKIDQVVLPIFYDTEPSDVRKQTGSYAKAFDEHEEHFKEEMEKVNKWRGALAEAGNLSGWGLNNEANGYEAEFIKRIVSDVACKLGNKTLHVAKH PVGIYSRVQGIISLLKGAKPDVGIVGIHGIAGIGKTTIAKAVLTNFIWI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.019G001314 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.019G003942 [exp]	1.00	0.9391
AT4G23160		CRK8	cysteine-rich RLK (RECEPTOR-li...		Potri.011G028901 [exp]	2.00	0.8444
AT4G00770			unknown protein		Potri.014G077400 [exp]	2.23	0.8362
					Potri.003G184501 [exp]	4.24	0.8290
AT3G44480		COG1, RPP10, RP...	recognition of peronospora par...		Potri.019G095866 [exp]	9.89	0.8272
AT4G01550	NAC	ANAC069, NTM2	NAC with Transmembrane Motif 2...		Potri.002G181800 [exp]	10.19	0.8057
					Potri.008G045467 [exp]	10.81	0.7184
AT5G23570		SGS3, ATSGS3	SUPPRESSOR OF GENE SILENCING 3...		Potri.001G037000 [exp]	11.48	0.8060
					Potri.019G002628 [exp]	12.96	0.8263
AT5G36930			Disease resistance protein (TI...		Potri.019G000657 [exp]	16.58	0.7557

Compare expression of checked genes

Potri.019G001314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.